Lus10010552 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G32090 197 / 3e-66 Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
AT2G28420 64 / 4e-13 GLYI8 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1)
AT1G80160 48 / 1e-07 GLYI7 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
AT1G15380 47 / 3e-07 GLYI4 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006122 282 / 9e-100 AT2G32090 199 / 3e-67 Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Lus10039579 57 / 9e-11 AT2G28420 248 / 2e-84 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1)
Lus10005324 54 / 2e-09 AT2G28420 245 / 2e-83 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1)
Lus10030070 45 / 4e-06 AT1G80160 247 / 7e-85 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Lus10014480 45 / 4e-06 AT1G80160 244 / 1e-83 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Lus10025971 42 / 5e-05 AT1G15380 165 / 3e-52 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Lus10014269 42 / 5e-05 AT1G15380 166 / 2e-52 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G087000 213 / 3e-72 AT2G32090 189 / 3e-63 Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.008G153602 152 / 9e-48 AT2G32090 139 / 8e-43 Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.009G055500 56 / 2e-10 AT2G28420 229 / 1e-77 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1)
Potri.001G171600 50 / 3e-08 AT1G80160 270 / 6e-94 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.003G062400 49 / 7e-08 AT1G80160 261 / 2e-90 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.003G009000 49 / 1e-07 AT1G80160 190 / 8e-62 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.004G223300 48 / 3e-07 AT1G80160 187 / 1e-60 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.007G015100 44 / 6e-06 AT1G15380 167 / 7e-53 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.005G117000 42 / 3e-05 AT1G80160 166 / 2e-52 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.007G129200 39 / 0.0002 AT1G80160 225 / 1e-76 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0104 Glyoxalase PF00903 Glyoxalase Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
Representative CDS sequence
>Lus10010552 pacid=23156641 polypeptide=Lus10010552 locus=Lus10010552.g ID=Lus10010552.BGIv1.0 annot-version=v1.0
ATGGCGGCAGCCTCGGCACCTATTCTTAGCCACATCGCCAGGGAATCCACAGACATTAGACGCCTGGCGAATTTCTACAAGGAGATCTTTGGGTTTGAGG
AGATAGAGACGCCGGATTTTGGATTCAACGTTATATGGCTGAATCTGGCTAATGCTTTCTCTTTCCACCTTATTGAGAGGAGCCCCGAGACCAAGCTTCC
AGAAGGACCTTACAGTGCTTCAGAGCCAATTCGCGATGTCACCCATCTCGCCGGAGGCCATCATATCTGTATCTCCGTCGCCAACTTCGACGCTTTTGTT
CAATCTCTTAAGGAGAAAGGGATAGAGACATTCCAGAGGGCAGTTCCTGGTCGGTCAATTAGGCAAGCTTTCTTCTTTGATCCAGATGGCAATGGACTGG
AGGTGGCAAGTCGGGATGAGTAG
AA sequence
>Lus10010552 pacid=23156641 polypeptide=Lus10010552 locus=Lus10010552.g ID=Lus10010552.BGIv1.0 annot-version=v1.0
MAAASAPILSHIARESTDIRRLANFYKEIFGFEEIETPDFGFNVIWLNLANAFSFHLIERSPETKLPEGPYSASEPIRDVTHLAGGHHICISVANFDAFV
QSLKEKGIETFQRAVPGRSIRQAFFFDPDGNGLEVASRDE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G32090 Lactoylglutathione lyase / gly... Lus10010552 0 1
AT1G17130 Family of unknown function (DU... Lus10005575 1.0 0.9399
AT2G39840 TOPP4 type one serine/threonine prot... Lus10040259 4.9 0.9201
AT4G39870 TLD-domain containing nucleola... Lus10041697 6.9 0.9303
AT1G08110 lactoylglutathione lyase famil... Lus10016138 7.3 0.9307
AT1G74100 SOT16, ATSOT16,... CORONATINE INDUCED-7, ARABIDOP... Lus10022904 9.8 0.9029
AT4G27130 Translation initiation factor ... Lus10039660 10.4 0.9185
Lus10021689 11.4 0.9193
AT5G03560 Tetratricopeptide repeat (TPR)... Lus10027932 14.1 0.9150
AT5G23590 DNAJ heat shock N-terminal dom... Lus10027828 15.2 0.9077
AT5G26610 D111/G-patch domain-containing... Lus10001513 16.7 0.9050

Lus10010552 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.