Lus10010556 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22480 199 / 9e-67 PDF2 prefoldin 2 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006117 293 / 1e-103 AT3G22480 197 / 7e-66 prefoldin 2 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G153900 250 / 5e-87 AT3G22480 196 / 1e-65 prefoldin 2 (.1.2)
Potri.001G240200 236 / 2e-81 AT3G22480 193 / 2e-64 prefoldin 2 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0200 Prefoldin PF01920 Prefoldin_2 Prefoldin subunit
Representative CDS sequence
>Lus10010556 pacid=23156693 polypeptide=Lus10010556 locus=Lus10010556.g ID=Lus10010556.BGIv1.0 annot-version=v1.0
ATGGCTGCCAGATCTGAGATGCAAGGGAAAGAGCCAGGAAATGAGCAGATGATAGCAAACATGTACACATCCATGAGATCTGAACTGAACCAGATTTACT
CCAAAATCACTGAACTGGAGATGGAAGTGAGCGAACATTCATTGGTCATGAACGCCATCCAACCACTCGACCCCAGCCGACGCTGTTACCGAATGATCGG
AGGTGTGCTTGTGGAAAGGAACATTAAGGAGGTGCTACCAGCCGTGCAGCGAAACAAAGAAGGAATCGAGGAAGTAATCTCGAGGCTGAATGAAGCCCTG
GAAAGGAAGAAGAAGGAGATCACCGATTTCGAAGCTAAATACAAGATCAGGATCAGGAAAGCAGATAACGAGGTGAAAGATGAAGGTAGCAAGAAGGAAG
GTGGCTCTCAGGGCGTCCTCGTCGGCCCTGCAGGCTCAAGTGAATGA
AA sequence
>Lus10010556 pacid=23156693 polypeptide=Lus10010556 locus=Lus10010556.g ID=Lus10010556.BGIv1.0 annot-version=v1.0
MAARSEMQGKEPGNEQMIANMYTSMRSELNQIYSKITELEMEVSEHSLVMNAIQPLDPSRRCYRMIGGVLVERNIKEVLPAVQRNKEGIEEVISRLNEAL
ERKKKEITDFEAKYKIRIRKADNEVKDEGSKKEGGSQGVLVGPAGSSE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G22480 PDF2 prefoldin 2 (.1.2) Lus10010556 0 1
AT1G01910 P-loop containing nucleoside t... Lus10036552 6.3 0.8107
AT5G11970 Protein of unknown function (D... Lus10021581 8.6 0.8427
AT5G25760 PEX4, UBC21 ubiquitin-conjugating enzyme 2... Lus10009495 10.0 0.8037
AT1G49590 C2H2 and C2HC zinc fingers sup... Lus10027913 13.1 0.8512
AT3G12760 unknown protein Lus10009599 13.4 0.8031
AT4G00170 Plant VAMP (vesicle-associated... Lus10036495 14.4 0.8052
AT3G27310 PUX1 plant UBX domain-containing pr... Lus10032080 14.7 0.8062
AT5G53280 PDV1 plastid division1 (.1) Lus10039325 19.4 0.7662
AT1G07170 PHF5-like protein (.1.2.3) Lus10018253 23.4 0.7809
AT1G53850 PAE1, ATPAE1 ARABIDOPSIS 20S PROTEASOME ALP... Lus10003936 23.7 0.7962

Lus10010556 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.