Lus10010557 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G14890 188 / 5e-61 FdC2 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
AT2G27510 89 / 4e-22 ATFD3 ferredoxin 3 (.1)
AT1G60950 80 / 8e-19 FED A, ATFD2, FEDA FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
AT1G10960 77 / 2e-17 ATFD1 ferredoxin 1 (.1)
AT5G10000 76 / 2e-17 ATFD4 ferredoxin 4 (.1)
AT1G32550 72 / 1e-15 FdC1 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006116 292 / 4e-102 AT4G14890 186 / 1e-61 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Lus10020616 90 / 2e-22 AT2G27510 172 / 9e-56 ferredoxin 3 (.1)
Lus10004870 89 / 6e-22 AT2G27510 165 / 5e-53 ferredoxin 3 (.1)
Lus10043430 84 / 3e-20 AT2G27510 179 / 3e-58 ferredoxin 3 (.1)
Lus10034144 83 / 7e-20 AT2G27510 179 / 1e-58 ferredoxin 3 (.1)
Lus10015462 79 / 2e-18 AT1G60950 182 / 8e-60 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Lus10001369 75 / 1e-16 AT1G60950 186 / 1e-61 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Lus10004576 71 / 6e-15 AT1G32550 248 / 6e-85 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
Lus10000483 69 / 3e-14 AT1G32550 245 / 7e-84 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G153200 227 / 2e-76 AT4G14890 193 / 2e-64 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.010G087300 221 / 3e-74 AT4G14890 189 / 7e-63 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.004G202500 89 / 7e-22 AT2G27510 164 / 3e-52 ferredoxin 3 (.1)
Potri.009G163800 82 / 1e-19 AT2G27510 167 / 7e-54 ferredoxin 3 (.1)
Potri.001G470700 80 / 9e-19 AT1G60950 174 / 7e-57 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.008G020100 80 / 1e-18 AT2G27510 180 / 5e-59 ferredoxin 3 (.1)
Potri.010G239100 75 / 7e-17 AT2G27510 175 / 7e-57 ferredoxin 3 (.1)
Potri.003G015200 72 / 7e-16 AT1G60950 176 / 2e-57 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.003G090400 70 / 9e-15 AT1G32550 257 / 3e-88 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
Potri.004G218400 67 / 4e-14 AT1G60950 194 / 9e-65 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0486 Fer2 PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Representative CDS sequence
>Lus10010557 pacid=23156638 polypeptide=Lus10010557 locus=Lus10010557.g ID=Lus10010557.BGIv1.0 annot-version=v1.0
ATGCACGCAGGACTACGTATTTCAGCGTCTTGGTACTTCAGTGTTGATGCTACTGTTCGACGGAGGCAAGCGATAGGTGCTTTAGGGGTCATCCTTCACA
GTCCAACCGGTCAAGTTAGCTCTGCCTATGGACTTGTCGTACATCATATTGTTGATCCATTGGCCTTGGAGTCTTTGGCAATCAGACCACACATCTCCCC
CCAGCGCCAAAACCTCGTTCCCTATCATCTCCCACCTCCAACCATGGCTACCCACACTGTTCCTTTTGCTCCAACTCCTGCCATTCCTCTAACCAAAACA
AAGCTATGGACCAAATTCCCTTCTTGTACAGTCAATAACAGAAAAGGAAGGTCCCTAAGAACGGTGGTTCGATCTTACAAAGTAGTGATTGAGCATCAGG
GTGAGTCCAGGGAGCTTGAAGTGGAGCCAGATGAGACCATACTATCCAAGGCACTGGACTCTGGCTTGTCCGTACCTCATGACTGCAAGCTTGGAGTGTG
TATGACTTGCCCAGCGAAGGTTGTCAGCGGGACTGTCGATCAGAGCGAAGGTATGCTCAGTGATGACGTGGTGGACGGCGGCTATGCATTGCTCTGTGTT
GCATATCCCACCTCTGATTGCCACATTAGAACCATTCCTGAGGAGGAGTTGCTCTCCCTCCAGCTTGCAACCGCTAATGACTAA
AA sequence
>Lus10010557 pacid=23156638 polypeptide=Lus10010557 locus=Lus10010557.g ID=Lus10010557.BGIv1.0 annot-version=v1.0
MHAGLRISASWYFSVDATVRRRQAIGALGVILHSPTGQVSSAYGLVVHHIVDPLALESLAIRPHISPQRQNLVPYHLPPPTMATHTVPFAPTPAIPLTKT
KLWTKFPSCTVNNRKGRSLRTVVRSYKVVIEHQGESRELEVEPDETILSKALDSGLSVPHDCKLGVCMTCPAKVVSGTVDQSEGMLSDDVVDGGYALLCV
AYPTSDCHIRTIPEEELLSLQLATAND

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G14890 FdC2 ferredoxin C 2, 2Fe-2S ferredo... Lus10010557 0 1
AT2G37660 NAD(P)-binding Rossmann-fold s... Lus10010846 3.5 0.9189
AT4G17600 LIL3:1 Chlorophyll A-B binding family... Lus10000959 3.6 0.9325
AT5G06290 2CPB, 2-CysPrxB... 2-CYS PEROXIREDOXIN B, 2-cyste... Lus10021295 6.2 0.9183
AT2G43630 unknown protein Lus10005311 6.3 0.8887
AT1G15820 CP24, LHCB6 light harvesting complex photo... Lus10015834 6.5 0.9083
AT1G60950 FED A, ATFD2, F... FERREDOXIN 2, 2Fe-2S ferredoxi... Lus10001369 8.5 0.9177
AT5G55740 CRR21 chlororespiratory reduction 21... Lus10004751 9.5 0.9003
AT1G15820 CP24, LHCB6 light harvesting complex photo... Lus10020415 11.0 0.9064
AT1G20340 PETE2, DRT112 PLASTOCYANIN 2, DNA-DAMAGE-REP... Lus10021839 12.0 0.8838
AT2G16030 S-adenosyl-L-methionine-depend... Lus10018506 13.5 0.8480

Lus10010557 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.