Lus10010559 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G59650 201 / 2e-68 mitochondrial ribosomal protein L51/S25/CI-B8 family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006114 249 / 2e-87 AT3G59650 204 / 2e-69 mitochondrial ribosomal protein L51/S25/CI-B8 family protein (.1.2)
Lus10022178 167 / 6e-51 AT3G59650 138 / 2e-39 mitochondrial ribosomal protein L51/S25/CI-B8 family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G126200 197 / 5e-67 AT3G59650 202 / 8e-69 mitochondrial ribosomal protein L51/S25/CI-B8 family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF05047 L51_S25_CI-B8 Mitochondrial ribosomal protein L51 / S25 / CI-B8 domain
Representative CDS sequence
>Lus10010559 pacid=23156648 polypeptide=Lus10010559 locus=Lus10010559.g ID=Lus10010559.BGIv1.0 annot-version=v1.0
ATGGCCTTACGAGGCGTTTGGCAGCTGAAAAAGCTGGTTGTGAGCTACAGTGATTGGGGTGGTAGCAGCAGGGGAATCAGGGCATTCATGGAGTCGCACC
TCCCAACATTGAAAGCTGAGAATCCCCATCTGAAGGTGGAAACTGAACTCATTCGAGGCCAGCACCCGCACTTAAAGGCCTTTTACAAAAACAACAATGA
AAGAGTGGTATGCGTGAGGAACATGAGTTCAGATGAAGTATTACTGCATGCTACCAGGCTAAGGAATGCATTGGGAAGAAAGGTGGTCAAACTGAAGACG
AGACATGTCACCAAACACCCAAGTGTACAAGGTACATGGACAACAGGGCTCAAGTTTGAGGAGGCATGA
AA sequence
>Lus10010559 pacid=23156648 polypeptide=Lus10010559 locus=Lus10010559.g ID=Lus10010559.BGIv1.0 annot-version=v1.0
MALRGVWQLKKLVVSYSDWGGSSRGIRAFMESHLPTLKAENPHLKVETELIRGQHPHLKAFYKNNNERVVCVRNMSSDEVLLHATRLRNALGRKVVKLKT
RHVTKHPSVQGTWTTGLKFEEA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G59650 mitochondrial ribosomal protei... Lus10010559 0 1
AT5G26800 unknown protein Lus10011180 5.0 0.8837
AT2G34160 Alba DNA/RNA-binding protein (... Lus10002901 13.5 0.8633
AT4G33250 ATTIF3K1, EIF3K eukaryotic translation initiat... Lus10027668 14.6 0.8720
AT4G34880 Amidase family protein (.1) Lus10027852 16.2 0.8221
AT1G36240 Ribosomal protein L7Ae/L30e/S1... Lus10019681 20.4 0.8565
AT4G14320 Zinc-binding ribosomal protein... Lus10010195 29.4 0.8547
AT5G27700 Ribosomal protein S21e (.1) Lus10015173 29.6 0.8576
AT4G33250 ATTIF3K1, EIF3K eukaryotic translation initiat... Lus10039931 29.8 0.8394
AT5G22330 ATTIP49A, RIN1 RESISTANCE TO PSEUDOMONAS SYRI... Lus10040479 33.3 0.8428
AT1G76010 Alba DNA/RNA-binding protein (... Lus10005615 33.6 0.8382

Lus10010559 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.