Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G10810 199 / 2e-64 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G60750 194 / 2e-62 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G60680 190 / 8e-61 AGD2 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G60730 187 / 9e-61 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2), NAD(P)-linked oxidoreductase superfamily protein (.3) AT1G60690 188 / 5e-60 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G60710 186 / 2e-59 ATB2 NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G21250 53 / 5e-09 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G21260 52 / 9e-09 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G04690 51 / 2e-08 KV-BETA1, KAB1 potassium channel beta subunit 1 (.1) AT5G53580 49 / 2e-07 AtPLR1 pyridoxal reductase 1, NAD(P)-linked oxidoreductase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006105 [exp] 208 / 5e-68 AT1G60690 554 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10037437 [exp] 200 / 8e-65 AT1G60690 571 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10041272 [exp] 200 / 9e-65 AT1G60710 571 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10023701 [exp] 180 / 8e-57 AT1G60690 527 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10029615 [exp] 174 / 1e-54 AT1G60710 399 / 2e-139 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10041185 [exp] 166 / 1e-51 AT1G60750 384 / 2e-133 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10041184 [exp] 165 / 6e-51 AT1G60690 374 / 1e-129 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10041303 [exp] 143 / 2e-43 AT1G60690 419 / 1e-148 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10037408 [exp] 125 / 4e-36 AT1G60730 311 / 6e-106 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2), NAD(P)-linked oxidoreductase superfamily protein (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G147700 [exp] 198 / 4e-64 AT1G60710 559 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.002G234201 [exp] 196 / 3e-63 AT1G60710 547 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.002G234000 [exp] 190 / 5e-61 AT1G60690 524 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.008G158300 [exp] 167 / 7e-52 AT1G60680 389 / 2e-135 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.013G040100 [exp] 164 / 6e-51 AT1G60710 369 / 1e-127 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.013G040000 [exp] 163 / 3e-50 AT1G60710 376 / 2e-130 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.005G052400 [exp] 160 / 3e-49 AT1G60680 395 / 1e-137 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.001G052100 [exp] 52 / 1e-08 AT1G04690 602 / 0.0 potassium channel beta subunit 1 (.1) Potri.015G042100 [exp] 48 / 2e-07 AT1G04420 294 / 4e-97 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.015G006900 [exp] 48 / 3e-07 AT5G53580 556 / 0.0 pyridoxal reductase 1, NAD(P)-linked oxidoreductase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00248 [flax] [poplar] Aldo_ket_red Aldo/keto reductase family
Representative CDS sequence Show only first row Show all	>Lus10010566 pacid=23156675 polypeptide=Lus10010566 locus=Lus10010566.g ID=Lus10010566.BGIv1.0 annot-version=v1.0 ATGGGAGCTCGTGGAGATCCTGCGTACGTAAGGGCTGCTTGTGAAGCTAGCCTCAAGAGGCTTCAAGTTGACTGCACCAATCTTTATTATCAGCATTCAA TCGACACCACCATTGCAATTGAAGTCACGGTTAGCGAGCTGAAGAAACTAGTTGAAGAGGGTAAAATAAAGTGCATTGGTCTGTCAGAGGCCTCTGCTGC GACAATCAGAAGACCTCATGCTGTACATCCTATAACAGCAGTGCAGTTGGAGTGGTCTTTGTGGTCAAGGTATGTGGAGGAAGATATTGTACCTGTCTGC AGAGAACTTGGGATTGGTATTGTTGCCTACAGTTCTCTTGGTCTGAGGTTCCGCGATCGAGCACTGTCAAGTAAGAGGAGGTGA
AA sequence Show only first row Show all	>Lus10010566 pacid=23156675 polypeptide=Lus10010566 locus=Lus10010566.g ID=Lus10010566.BGIv1.0 annot-version=v1.0 MGARGDPAYVRAACEASLKRLQVDCTNLYYQHSIDTTIAIEVTVSELKKLVEEGKIKCIGLSEASAATIRRPHAVHPITAVQLEWSLWSRYVEEDIVPVC RELGIGIVAYSSLGLRFRDRALSSKRR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G10810			NAD(P)-linked oxidoreductase s...		Lus10010566 [exp]	0	1
AT3G02100			UDP-Glycosyltransferase superf...		Lus10003455 [exp]	11.7	0.8788
AT1G78780			pathogenesis-related family pr...		Lus10042792 [exp]	19.1	0.8653
AT2G47485			unknown protein		Lus10009157 [exp]	20.4	0.7909
AT5G17000			Zinc-binding dehydrogenase fam...		Lus10004379 [exp]	21.2	0.8672
AT5G06740			Concanavalin A-like lectin pro...		Lus10016257 [exp]	25.4	0.8516
AT1G76690		OPR2, ATOPR2	ARABIDOPSIS 12-OXOPHYTODIENOAT...		Lus10001274 [exp]	26.7	0.8437
					Lus10036438 [exp]	28.6	0.8296
AT4G36920	AP2_ERF	FL1, FLO2, AP2	FLORAL MUTANT 2, FLOWER 1, APE...		Lus10004990 [exp]	38.2	0.8455
					Lus10006615 [exp]	46.7	0.8266
AT1G65820			microsomal glutathione s-trans...		Lus10020793 [exp]	49.4	0.8296

Compare expression of checked genes

Lus10010566 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.