Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22600 144 / 4e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 123 / 4e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 115 / 7e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 96 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G13820 74 / 4e-17 AtXYP2 xylogen protein 2, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G55260 75 / 1e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G09370 71 / 3e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G43720 69 / 1e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G22580 65 / 6e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G64080 62 / 2e-12 AtXYP1 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039348 [exp] 227 / 6e-77 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021912 [exp] 160 / 1e-50 AT3G22600 125 / 7e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10041197 [exp] 157 / 3e-49 AT3G22600 117 / 9e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10014681 [exp] 122 / 2e-35 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042611 [exp] 118 / 5e-34 AT3G22600 142 / 1e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042612 [exp] 108 / 1e-29 AT3G22600 121 / 9e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010573 [exp] 106 / 1e-29 AT3G22600 117 / 5e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10022066 [exp] 105 / 4e-29 AT3G22600 121 / 2e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039349 [exp] 101 / 1e-27 AT3G22600 119 / 9e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G085400 [exp] 166 / 4e-53 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 161 / 4e-51 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G211800 [exp] 135 / 1e-40 AT3G22600 160 / 6e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050500 [exp] 131 / 3e-39 AT3G22600 129 / 2e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G211900 [exp] 117 / 2e-33 AT2G48130 89 / 3e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050300 [exp] 115 / 8e-33 AT3G22600 117 / 3e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050400 [exp] 114 / 4e-32 AT3G22600 100 / 1e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085300 [exp] 109 / 1e-30 AT3G22600 66 / 5e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G020200 [exp] 73 / 2e-16 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.009G158100 [exp] 67 / 3e-14 AT3G43720 106 / 5e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10010572 pacid=23156631 polypeptide=Lus10010572 locus=Lus10010572.g ID=Lus10010572.BGIv1.0 annot-version=v1.0 ATGGCAGGAAGCAAGATGGCAATGAGTTTGGGTATTGTGTTGCTTACCATGCAGCTGTGGGCAGGAGGAGCAAGGGCTCAGTCGGACTGTACCAACGTGC TCATCAGCTTGTCCCCTTGCCTGAATTACATCACCGGGAACTCGTCGACCCCACCCCAGCAGTGCTGCTCGCAGTTAGCTACTGTGGTTCGTTCCTCCCC ACTGTGTCTCTGCCAGCTTCTCAACGGTGGTGGCTCCTCATTCGGTGTCAATATCAACCAGACTAAGGCTTTAGAATTGCCTCGTGCTTGTAATGTTCAG ACTCCACCCATCAGCCGCTGCAATGCTTCTACTCCAACTGCTGCTCCAGAGGGAAGCCCAGTACCAGGCATTCCAACTACTCCAGGTGGATCCGGAAGTG TGCCATCAACACCAGGCACTGGCTCATCAGATGGCAGCTCCATCATGATGTCAATGTCTTTGATCTTGTTCTCCCTCCTTGCAGCCTCATACAGTTCTGC ATTCATGAGATGA
AA sequence Show only first row Show all	>Lus10010572 pacid=23156631 polypeptide=Lus10010572 locus=Lus10010572.g ID=Lus10010572.BGIv1.0 annot-version=v1.0 MAGSKMAMSLGIVLLTMQLWAGGARAQSDCTNVLISLSPCLNYITGNSSTPPQQCCSQLATVVRSSPLCLCQLLNGGGSSFGVNINQTKALELPRACNVQ TPPISRCNASTPTAAPEGSPVPGIPTTPGGSGSVPSTPGTGSSDGSSIMMSMSLILFSLLAASYSSAFMR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10010572 [exp]	0	1
AT1G22150		SULTR1;3	sulfate transporter 1;3 (.1)		Lus10036437 [exp]	4.7	0.9195
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10039348 [exp]	6.9	0.9216
AT4G21970			Protein of unknown function, D...		Lus10021536 [exp]	10.2	0.8926
AT1G22150		SULTR1;3	sulfate transporter 1;3 (.1)		Lus10041111 [exp]	11.6	0.8845
AT3G59140		ATMRP14, ABCC10	ATP-binding cassette C10, mult...		Lus10039320 [exp]	13.0	0.8894
AT2G36780			UDP-Glycosyltransferase superf...		Lus10014437 [exp]	13.3	0.8188
AT4G37370		CYP81D8	"cytochrome P450, family 81, s...		Lus10020437 [exp]	13.4	0.8948
AT1G75130		CYP721A1	"cytochrome P450, family 721, ...		Lus10016310 [exp]	14.7	0.8964
AT1G78780			pathogenesis-related family pr...		Lus10042792 [exp]	16.9	0.8947
					Lus10036438 [exp]	18.3	0.8742

Compare expression of checked genes

Lus10010572 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.