Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G05450 110 / 8e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G48140 96 / 2e-25 EDA4 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G22620 91 / 2e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 54 / 5e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 52 / 3e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 47 / 8e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 46 / 4e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G43720 44 / 1e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G73890 43 / 4e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G09370 42 / 6e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021911 [exp] 113 / 4e-31 AT1G05450 121 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10041196 [exp] 113 / 5e-31 AT1G05450 122 / 5e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10022067 [exp] 110 / 8e-30 AT2G48140 122 / 2e-35 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10042613 [exp] 97 / 7e-25 AT2G48140 107 / 1e-29 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10006906 [exp] 93 / 5e-24 AT2G48140 119 / 1e-35 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10014683 [exp] 97 / 6e-24 AT2G48140 145 / 6e-43 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10039348 [exp] 52 / 3e-08 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010572 [exp] 50 / 9e-08 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10006908 [exp] 51 / 1e-07 AT3G22600 99 / 4e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G085200 [exp] 119 / 2e-33 AT1G05450 134 / 2e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.008G155200 [exp] 115 / 6e-32 AT2G48140 121 / 2e-34 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.005G212000 [exp] 110 / 6e-30 AT2G48140 113 / 4e-32 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.002G050200 [exp] 99 / 1e-25 AT2G48140 127 / 1e-37 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.010G085400 [exp] 48 / 5e-07 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 47 / 1e-06 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232000 [exp] 46 / 5e-06 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G020200 [exp] 44 / 2e-05 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.015G053700 [exp] 44 / 2e-05 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G054000 [exp] 44 / 2e-05 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10010575 pacid=23156665 polypeptide=Lus10010575 locus=Lus10010575.g ID=Lus10010575.BGIv1.0 annot-version=v1.0 ATGGCATCTTTGACGCTCAATTCGCAAACTGTTGTGCTTCTTTCCGTTGCTTCATTTCTCCTACTCCTCCAGTTTCCACAAGTCCTACATGCCCAAATCA CCACCCCTTGCACCGCCACAGGAATCACTGGACTCACCCCTTGTATGAACTTCCTCACCAACAGCTCTGGCAACGGAGCATCCTCCCCGACTCAAGACTG TTGCAATTCCCTCAAGAACCTCACCGGTGCTAGCATGGACTGCATTTGCCTTGTTCTCGCCGCTGGTGTTCCTTTCCAGGTTCCCATCAACAGAAACTTA GCCATCACCCTCCCTCGCGCCTGTAACATGCCTGGTGTCCCTCTCCAATGCAAAGCTGCTGCTGGTTCTCCAGTTCCTGCTCCAGGTCCAGCAGTACTTG GACCATCATCTCTGGCTCCTGGAGTTTCGCCTTCAGATACTCCCTCAAGTGAGAATTCATCAACTCGTTCAGTTGTTCCAGGAACACCTTCAGATGGTTC AACACCAGGATCAGGCACAACAACACCATCATCCATGACTCCGCCATCATCAACTACTCCAACAACCATTAACTCTTCACCACCGTCCTCTTACAGCCTC TCACTATATCTTCTGATCTTGGCACTGGCGTTTCTACTCATCAAGTTCAACTAG
AA sequence Show only first row Show all	>Lus10010575 pacid=23156665 polypeptide=Lus10010575 locus=Lus10010575.g ID=Lus10010575.BGIv1.0 annot-version=v1.0 MASLTLNSQTVVLLSVASFLLLLQFPQVLHAQITTPCTATGITGLTPCMNFLTNSSGNGASSPTQDCCNSLKNLTGASMDCICLVLAAGVPFQVPINRNL AITLPRACNMPGVPLQCKAAAGSPVPAPGPAVLGPSSLAPGVSPSDTPSSENSSTRSVVPGTPSDGSTPGSGTTTPSSMTPPSSTTPTTINSSPPSSYSL SLYLLILALAFLLIKFN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G05450			Bifunctional inhibitor/lipid-t...		Lus10010575 [exp]	0	1
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10042611 [exp]	1.4	0.9663
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10022065 [exp]	2.0	0.9639
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10006909 [exp]	2.0	0.9396
AT4G25560	MYB	LAF1, ATMYB18	LONG AFTER FAR-RED LIGHT 1, my...		Lus10027458 [exp]	3.5	0.9188
AT3G07840			Pectin lyase-like superfamily ...		Lus10003001 [exp]	3.6	0.9014
AT2G18360			alpha/beta-Hydrolases superfam...		Lus10041747 [exp]	4.9	0.9570
AT5G09530		PRP10, PELPK1	proline-rich protein 10, Pro-G...		Lus10018841 [exp]	7.4	0.9329
					Lus10033358 [exp]	11.0	0.9074
AT5G09530		PRP10, PELPK1	proline-rich protein 10, Pro-G...		Lus10033357 [exp]	11.7	0.9181
AT1G74460			GDSL-like Lipase/Acylhydrolase...		Lus10034459 [exp]	12.4	0.9161

Compare expression of checked genes

Lus10010575 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.