Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022973 [exp] 110 / 5e-31 AT5G45310 189 / 1e-57 unknown protein Lus10001616 [exp] 109 / 1e-30 AT5G45310 185 / 5e-56 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G234300 [exp] 47 / 2e-07 AT5G45310 229 / 1e-72 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010582 pacid=23169673 polypeptide=Lus10010582 locus=Lus10010582.g ID=Lus10010582.BGIv1.0 annot-version=v1.0 ATGAGAGAATGGTCAACTCTGGAAGAGCGATTAGCCGTGGTGCAAGCTGAGCTAGCTGATGTTAATTGGGAAAAGAAGGTGCTTGAGGATCACCTGCGTC TTGCCGTTAAGGAATGTAACGATTTGGATTCGTTGTTGGCTGAAGCTGAAGATGAAGTTGATAAAATGGTTGCCAAAATCCAGCTGCTGCCAAAACAGGT ACATTATTCATCGTCTTTGGTTACGCAGTTTAGTACTTCATATGAGGAATCTAGTTAA
AA sequence Show only first row Show all	>Lus10010582 pacid=23169673 polypeptide=Lus10010582 locus=Lus10010582.g ID=Lus10010582.BGIv1.0 annot-version=v1.0 MREWSTLEERLAVVQAELADVNWEKKVLEDHLRLAVKECNDLDSLLAEAEDEVDKMVAKIQLLPKQVHYSSSLVTQFSTSYEESS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10010582 [exp]	0	1
AT2G25270			unknown protein		Lus10014341 [exp]	1.4	0.8882
AT3G04070	NAC	ANAC047	NAC domain containing protein ...		Lus10036959 [exp]	1.4	0.8929
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10007102 [exp]	3.5	0.8732
AT1G72940			Toll-Interleukin-Resistance (T...		Lus10041605 [exp]	3.5	0.8370
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10003264 [exp]	4.4	0.8032
					Lus10024677 [exp]	10.0	0.8277
AT5G67440		MEL2, NPY3	NAKED PINS IN YUC MUTANTS 3, M...		Lus10025193 [exp]	11.0	0.8161
AT1G15170			MATE efflux family protein (.1...		Lus10002200 [exp]	11.2	0.6941
					Lus10035026 [exp]	11.8	0.8161
AT1G47550		SEC3A	exocyst complex component sec3...		Lus10001022 [exp]	12.6	0.8161

Compare expression of checked genes

Lus10010582 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.