Lus10010593 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010734 185 / 8e-59 AT1G69980 159 / 1e-47 unknown protein
Lus10029192 174 / 4e-56 ND /
Lus10009191 174 / 4e-56 ND /
Lus10012669 158 / 4e-49 ND /
Lus10025380 165 / 4e-48 AT3G07610 516 / 8e-170 increase in bonsai methylation 1, Transcription factor jumonji (jmjC) domain-containing protein (.1), Transcription factor jumonji (jmjC) domain-containing protein (.2), Transcription factor jumonji (jmjC) domain-containing protein (.3)
Lus10033972 143 / 7e-44 AT4G15610 46 / 3e-06 Uncharacterised protein family (UPF0497) (.1)
Lus10010252 144 / 4e-43 ND /
Lus10024766 140 / 1e-42 ND /
Lus10034512 137 / 2e-42 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10010593 pacid=23169661 polypeptide=Lus10010593 locus=Lus10010593.g ID=Lus10010593.BGIv1.0 annot-version=v1.0
ATGAACAAGTTTCACCACCCCGATGAGTCAAAGGATTTGTTCATCTACTTTGAAGAAGAAGTGAAGTGTGATTGCGGATTTCGTGCACTGAGACAAATGA
TGCTGAAGTTCGAGAAATACTTCAATTGTCCTTTCTATAACTGTAGGTTCGAGAAGAAGTTGGAGATGGTGTTGCCTGAGAACTCGGTGAGGCACGAGAT
GAGAGCTACAATAGAGGCGAAGCTTGCTAAGAAGGATGATGAGATTGAAGCTGTTCGTGCTGAGCTGGCACATGATCGTTCTGAATGGCAACATGAGAGG
ATAGGCATCATACGGTCAAAGGAGACCATTGGTAACAACAAACTACGTCAATCTGTCAACGTGGCATCATACAACTGGGTGGGGGCACCAGCTCAGCAAT
CCACAACAGCATTCATCTCCGACTTAGTGCCATCTGGCCTCCTTCCCCGTAGTTAA
AA sequence
>Lus10010593 pacid=23169661 polypeptide=Lus10010593 locus=Lus10010593.g ID=Lus10010593.BGIv1.0 annot-version=v1.0
MNKFHHPDESKDLFIYFEEEVKCDCGFRALRQMMLKFEKYFNCPFYNCRFEKKLEMVLPENSVRHEMRATIEAKLAKKDDEIEAVRAELAHDRSEWQHER
IGIIRSKETIGNNKLRQSVNVASYNWVGAPAQQSTTAFISDLVPSGLLPRS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10010593 0 1
Lus10039439 1.0 0.9999
Lus10013528 9.9 0.9981
AT3G44540 FAR4 fatty acid reductase 4 (.1.2) Lus10019187 13.4 0.9997
Lus10036646 15.2 0.9963
AT3G15850 JB67, FADB, ADS... FATTY ACID DESATURASE B, fatty... Lus10009469 16.7 0.9996
Lus10028932 19.3 0.9995
AT1G02790 PGA4 polygalacturonase 4 (.1) Lus10012489 19.4 0.9921
AT4G22756 ATSMO1-2, ATSMO... sterol C4-methyl oxidase 1-2 (... Lus10028908 21.6 0.9995
AT4G17260 Lactate/malate dehydrogenase f... Lus10028931 23.6 0.9995
AT1G50310 ATSTP9 sugar transporter 9 (.1) Lus10013441 24.7 0.9979

Lus10010593 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.