Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043004 [exp] 112 / 8e-31 ND 47 / 8e-06 Lus10005472 [exp] 90 / 5e-24 ND / Lus10022156 [exp] 89 / 5e-23 ND / Lus10019612 [exp] 82 / 3e-21 ND / Lus10017834 [exp] 81 / 3e-20 ND / Lus10012388 [exp] 79 / 2e-19 ND / Lus10005473 [exp] 76 / 2e-19 ND / Lus10018996 [exp] 72 / 2e-16 ND / Lus10005607 [exp] 64 / 2e-13 ND 38 / 0.003
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010602 pacid=23177431 polypeptide=Lus10010602 locus=Lus10010602.g ID=Lus10010602.BGIv1.0 annot-version=v1.0 ATGGCACAATACTGGAAGACTTGGGATGTTGAGGTACTAACCTCTGAGGGTGTTAGGGACAGGAAGTCTATTGCTAGTGCATGGATTCTTACCGTTGATC ATAAAATGAGGGATTTGTGTATAACTGCAGAATTGGATATACCATTTGAGGATGCAAAAAAGTTTGTGAAGAAATTGAGAGATTATCGAGTCTGGATGTG GGAAGACCGAATGTTGAAGAATGATAACATCCCAAAACCACTCTCTACAAAAGCTTCCAGAGCATCTTGTATTGCAGCCAGGCCTAGGCATATTCCTCCA CCTATGTGGACACAATTGGTGGACTACAAGCTGAGACCGGAAGTTCAGATAAGCAAATGA
AA sequence Show only first row Show all	>Lus10010602 pacid=23177431 polypeptide=Lus10010602 locus=Lus10010602.g ID=Lus10010602.BGIv1.0 annot-version=v1.0 MAQYWKTWDVEVLTSEGVRDRKSIASAWILTVDHKMRDLCITAELDIPFEDAKKFVKKLRDYRVWMWEDRMLKNDNIPKPLSTKASRASCIAARPRHIPP PMWTQLVDYKLRPEVQISK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10010602 [exp]	0	1
AT5G46940			Plant invertase/pectin methyle...		Lus10031483 [exp]	5.7	0.7081
					Lus10025405 [exp]	8.8	0.5625
AT5G19750			Peroxisomal membrane 22 kDa (M...		Lus10039003 [exp]	15.2	0.6177
					Lus10008296 [exp]	18.2	0.6505
					Lus10022623 [exp]	24.5	0.6528
AT2G39530			Uncharacterised protein family...		Lus10031305 [exp]	28.8	0.6117
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10023499 [exp]	29.0	0.6365
					Lus10000914 [exp]	29.9	0.6117
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Lus10003094 [exp]	31.7	0.5040
					Lus10009804 [exp]	35.9	0.6100

Compare expression of checked genes

Lus10010602 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.