Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G12350 106 / 6e-29 F-box family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018673 [exp] 151 / 5e-45 AT3G12350 365 / 1e-123 F-box family protein (.1.2) Lus10007750 [exp] 116 / 3e-34 ND 103 / 1e-27
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G117900 [exp] 151 / 7e-45 AT3G12350 374 / 7e-127 F-box family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010606 pacid=23177420 polypeptide=Lus10010606 locus=Lus10010606.g ID=Lus10010606.BGIv1.0 annot-version=v1.0 ATGGACAATTCATCACCCTACTCCGTTGCCGATTTTCCGGAGGACGTGCTGCTTTGCATCCTGTCATTCCTCCCCTCGAAGGAGATCTCTAATTTCCCAT CCACATCGAAGCGGTTCGTCCGCATTTGTCACCCAGAAAGCAAGCTCGGGTACGCTCTTTGCCAGAGGCGGTGGGGGTCCAAGACCCATATCCAAAAGTG GGGGAATGGCAAGATCTCGTACAAGCTCTTGTACATGACGCTTAATAAATGGGAGAACTTGATCGGGTTCTGGCGCCGCTGCGGCCAGAGTCAGCAGAAC GCCGGCCTTACCAAACCGCCGGTTCTTCGAGTGGGGGCCTTGGTTCCTTCGCGGCTCCAGACTCTCTCCCTCCGAAAATGGTACGCATAG
AA sequence Show only first row Show all	>Lus10010606 pacid=23177420 polypeptide=Lus10010606 locus=Lus10010606.g ID=Lus10010606.BGIv1.0 annot-version=v1.0 MDNSSPYSVADFPEDVLLCILSFLPSKEISNFPSTSKRFVRICHPESKLGYALCQRRWGSKTHIQKWGNGKISYKLLYMTLNKWENLIGFWRRCGQSQQN AGLTKPPVLRVGALVPSRLQTLSLRKWYA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G12350			F-box family protein (.1.2)		Lus10010606 [exp]	0	1
AT2G43180			Phosphoenolpyruvate carboxylas...		Lus10025529 [exp]	5.6	0.7576
AT3G49730			Tetratricopeptide repeat (TPR)...		Lus10027318 [exp]	12.6	0.6869
AT4G34135		UGT73B2	UDP-glucosyltransferase 73B2 (...		Lus10027880 [exp]	13.3	0.7320
AT2G33255			Haloacid dehalogenase-like hyd...		Lus10004405 [exp]	19.2	0.7389
AT5G52560		ATUSP	UDP-sugar pyrophosphorylase (....		Lus10000971 [exp]	22.2	0.7054
AT1G27070			5'-AMP-activated protein kinas...		Lus10013279 [exp]	24.4	0.6980
AT2G40280			S-adenosyl-L-methionine-depend...		Lus10040950 [exp]	31.6	0.7059
AT3G52950			CBS / octicosapeptide/Phox/Bem...		Lus10035965 [exp]	33.8	0.7078
AT2G26270			unknown protein		Lus10038079 [exp]	45.6	0.6616
					Lus10006920 [exp]	60.0	0.6722

Compare expression of checked genes

Lus10010606 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.