Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G12350 64 / 1e-13 F-box family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007749 [exp] 107 / 7e-30 AT3G12350 217 / 3e-68 F-box family protein (.1.2) Lus10018673 [exp] 107 / 7e-29 AT3G12350 365 / 1e-123 F-box family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G117900 [exp] 99 / 6e-26 AT3G12350 374 / 7e-127 F-box family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010607 pacid=23177435 polypeptide=Lus10010607 locus=Lus10010607.g ID=Lus10010607.BGIv1.0 annot-version=v1.0 ATGCATATCCGACCACCTCCTGATGAAAATGAAAATTACGTGGACTATCAAGTTCTGGTGCGTGTCATGTACATCAATTCGAGTTTCGACCTGGTGATTC CAAGACTGGAAGGAACTGCAGCAAATCCTTGGCGAGTTGAGGGAAGGATTTGGCAGTACAAGTGTGGGGCTTTCGGGTTTGGATTTCTTCGTGATAATTT TATAGTAGATCTGAAACATATTGCCCGAGATGCTGCTCTTCTTGATGCCATTGCTCCTTCCTAG
AA sequence Show only first row Show all	>Lus10010607 pacid=23177435 polypeptide=Lus10010607 locus=Lus10010607.g ID=Lus10010607.BGIv1.0 annot-version=v1.0 MHIRPPPDENENYVDYQVLVRVMYINSSFDLVIPRLEGTAANPWRVEGRIWQYKCGAFGFGFLRDNFIVDLKHIARDAALLDAIAPS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G12350			F-box family protein (.1.2)		Lus10010607 [exp]	0	1
AT1G64850			Calcium-binding EF hand family...		Lus10013613 [exp]	2.4	0.8141
AT4G09620			Mitochondrial transcription te...		Lus10009420 [exp]	5.5	0.8035
AT5G28910			unknown protein		Lus10027959 [exp]	11.5	0.7438
AT4G23330			unknown protein		Lus10032266 [exp]	11.5	0.7677
AT3G48240			Octicosapeptide/Phox/Bem1p fam...		Lus10019490 [exp]	12.4	0.7904
AT5G51980	C3HZnF		Transducin/WD40 repeat-like su...		Lus10001652 [exp]	12.8	0.7821
AT2G24220		ATPUP5	purine permease 5 (.1.2)		Lus10022148 [exp]	14.8	0.7970
					Lus10033727 [exp]	14.9	0.8054
AT4G14600			Target SNARE coiled-coil domai...		Lus10041130 [exp]	17.0	0.7317
AT4G25440	C3HZnF	ZFWD1	zinc finger WD40 repeat protei...		Lus10021640 [exp]	17.3	0.7661

Compare expression of checked genes

Lus10010607 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.