Lus10010608 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G10200 0 / 1 LIM WLIM1, SF3 WLIM1, GATA type zinc finger transcription factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018674 41 / 6e-05 AT1G10200 323 / 4e-114 WLIM1, GATA type zinc finger transcription factor family protein (.1)
Lus10007748 0 / 1 AT1G10200 308 / 5e-108 WLIM1, GATA type zinc finger transcription factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G015600 0 / 1 AT1G10200 327 / 8e-116 WLIM1, GATA type zinc finger transcription factor family protein (.1)
Potri.002G118000 0 / 1 AT1G10200 325 / 7e-115 WLIM1, GATA type zinc finger transcription factor family protein (.1)
PFAM info
Representative CDS sequence
>Lus10010608 pacid=23177430 polypeptide=Lus10010608 locus=Lus10010608.g ID=Lus10010608.BGIv1.0 annot-version=v1.0
ATGCTTGTGCTGACTCCACGATTCCACCAAATCGATGATATTATCATGGATTGCCGTAGATTGAACTCGAAAGTCTGGAACTTTAAGAATTTTGGTAGGG
ATCGCTATAATGACCTCATCATCTTGGCAATTACAATTCCTTTGAAGGGGTTCTCTATTGCCGGCCACAGTTTGATCAGGTATTCAAAAGAAGTGGAAGC
CTTGAGAATCAAAAGCTTTGATGGGACTCCCAAGATAGAAAAACCTGAGAAACAGGTTGACACTTATCCTCCAGCAAGAGTTGTTCTTAAAATGCATCAT
TACTTGCTTCGGCTGCAGTATATCCAACTGAAAAGGTTTGAGTAA
AA sequence
>Lus10010608 pacid=23177430 polypeptide=Lus10010608 locus=Lus10010608.g ID=Lus10010608.BGIv1.0 annot-version=v1.0
MLVLTPRFHQIDDIIMDCRRLNSKVWNFKNFGRDRYNDLIILAITIPLKGFSIAGHSLIRYSKEVEALRIKSFDGTPKIEKPEKQVDTYPPARVVLKMHH
YLLRLQYIQLKRFE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10010608 0 1
AT3G07680 emp24/gp25L/p24 family/GOLD fa... Lus10036603 5.1 0.9442
AT5G08100 ASPGA1 asparaginase A1, N-terminal nu... Lus10017879 7.3 0.9341
AT3G61660 unknown protein Lus10033949 9.5 0.9216
AT1G14185 Glucose-methanol-choline (GMC)... Lus10032347 10.4 0.9329
AT1G60790 TBL2 TRICHOME BIREFRINGENCE-LIKE 2,... Lus10030590 11.3 0.9234
AT1G16310 Cation efflux family protein (... Lus10001768 15.5 0.9337
AT1G14180 RING/U-box superfamily protein... Lus10036764 21.2 0.9297
AT4G37980 ELI3-1, ATCAD7 CINNAMYL-ALCOHOL DEHYDROGENASE... Lus10023268 23.9 0.9204
Lus10005241 24.1 0.8751
AT3G21360 2-oxoglutarate (2OG) and Fe(II... Lus10006835 24.3 0.9297

Lus10010608 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.