Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G19880 48 / 8e-08 Regulator of chromosome condensation (RCC1) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033168 [exp] 84 / 1e-20 AT1G19880 724 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Lus10002850 [exp] 72 / 3e-16 AT3G51820 518 / 0.0 PIGMENT DEFECTIVE 325, UbiA prenyltransferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G236000 [exp] 56 / 7e-11 AT1G19880 674 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.002G026600 [exp] 41 / 1e-05 AT1G19880 703 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010614 pacid=23143664 polypeptide=Lus10010614 locus=Lus10010614.g ID=Lus10010614.BGIv1.0 annot-version=v1.0 ATGTCGGCTGGTGAACCGGAGAAGAAGGTGGACGAGGAAGGAACAGACAAGAAAGGAGGGGAGTTGCTATTCTGTGGGGCCACGTGTTGGGATGTTATTA GCCGCAAGAAAGGTCTTCTGCTATCAAATGCAGTTCGATCAAGTGTAGTGATGAAGAACAAACGGAGAAATGAAGAACAGACGGAGCAGAAGGTGGAGAC CGTTAGTCAACGTCAAGACACAAAGAGAATTGGAGCTTAA
AA sequence Show only first row Show all	>Lus10010614 pacid=23143664 polypeptide=Lus10010614 locus=Lus10010614.g ID=Lus10010614.BGIv1.0 annot-version=v1.0 MSAGEPEKKVDEEGTDKKGGELLFCGATCWDVISRKKGLLLSNAVRSSVVMKNKRRNEEQTEQKVETVSQRQDTKRIGA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G19880			Regulator of chromosome conden...		Lus10010614 [exp]	0	1
AT3G53170			Tetratricopeptide repeat (TPR)...		Lus10024144 [exp]	2.4	0.7532
					Lus10011276 [exp]	12.2	0.6473
AT5G20690			Leucine-rich repeat protein ki...		Lus10005175 [exp]	12.3	0.6370
AT3G10660		ATCPK2, CPK2	calmodulin-domain protein kina...		Lus10016190 [exp]	14.5	0.6414
AT1G01970			Tetratricopeptide repeat (TPR)...		Lus10015865 [exp]	15.9	0.5682
AT2G40190		LEW3	LEAF WILTING 3, UDP-Glycosyltr...		Lus10007909 [exp]	21.3	0.6343
AT3G07610		IBM1	increase in bonsai methylation...		Lus10004602 [exp]	23.4	0.5708
AT5G66400		ATDI8, RAB18	RESPONSIVE TO ABA 18, ARABIDOP...		Lus10041969 [exp]	24.7	0.5145
AT1G65450			HXXXD-type acyl-transferase fa...		Lus10029920 [exp]	26.8	0.6170
AT2G48060			unknown protein		Lus10035352 [exp]	26.8	0.5987

Compare expression of checked genes

Lus10010614 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.