Lus10010615 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G27190 69 / 2e-15 Leucine-rich repeat protein kinase family protein (.1)
AT1G69990 64 / 1e-13 Leucine-rich repeat protein kinase family protein (.1)
AT3G28450 57 / 3e-11 Leucine-rich repeat protein kinase family protein (.1)
AT5G16500 51 / 3e-09 Protein kinase superfamily protein (.1)
AT3G02810 50 / 5e-09 Protein kinase superfamily protein (.1)
AT5G02290 50 / 6e-09 NAK Protein kinase superfamily protein (.1.2)
AT5G07280 49 / 1e-08 EXS, EMS1 EXTRA SPOROGENOUS CELLS, EXCESS MICROSPOROCYTES1, Leucine-rich repeat transmembrane protein kinase (.1)
AT1G55610 49 / 2e-08 BRL1 BRI1 like (.1.2)
AT1G61590 48 / 4e-08 Protein kinase superfamily protein (.1)
AT2G01950 48 / 5e-08 VH1, BRL2 VASCULAR HIGHWAY 1, BRI1-like 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030811 79 / 8e-19 AT1G27190 772 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10013288 76 / 3e-18 AT1G27190 390 / 2e-133 Leucine-rich repeat protein kinase family protein (.1)
Lus10034757 49 / 1e-08 AT1G61590 624 / 0.0 Protein kinase superfamily protein (.1)
Lus10033294 49 / 2e-08 AT1G61590 552 / 0.0 Protein kinase superfamily protein (.1)
Lus10033533 49 / 2e-08 AT4G39400 1492 / 0.0 DWARF 2, CABBAGE 2, BRASSINOSTEROID INSENSITIVE 1, BR INSENSITIVE 1, Leucine-rich receptor-like protein kinase family protein (.1)
Lus10039132 48 / 4e-08 AT2G01950 1503 / 0.0 VASCULAR HIGHWAY 1, BRI1-like 2 (.1)
Lus10038726 48 / 4e-08 AT2G01950 1501 / 0.0 VASCULAR HIGHWAY 1, BRI1-like 2 (.1)
Lus10034897 48 / 5e-08 AT2G05940 636 / 0.0 RPM1-induced protein kinase, Protein kinase superfamily protein (.1)
Lus10033429 48 / 6e-08 AT2G05940 636 / 0.0 RPM1-induced protein kinase, Protein kinase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G074400 69 / 2e-15 AT3G28450 761 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.004G081700 67 / 6e-15 AT1G27190 747 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.017G138600 67 / 7e-15 AT1G27190 712 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.001G349900 65 / 3e-14 AT3G28450 764 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.001G128500 51 / 2e-09 AT1G61590 622 / 0.0 Protein kinase superfamily protein (.1)
Potri.007G144000 50 / 2e-09 AT5G48380 162 / 4e-47 BAK1-interacting receptor-like kinase 1 (.1)
Potri.008G078900 50 / 6e-09 AT5G48380 734 / 0.0 BAK1-interacting receptor-like kinase 1 (.1)
Potri.002G240000 50 / 8e-09 AT5G48380 721 / 0.0 BAK1-interacting receptor-like kinase 1 (.1)
Potri.005G086500 50 / 1e-08 AT4G39400 1398 / 0.0 DWARF 2, CABBAGE 2, BRASSINOSTEROID INSENSITIVE 1, BR INSENSITIVE 1, Leucine-rich receptor-like protein kinase family protein (.1)
Potri.015G141200 49 / 1e-08 AT5G07280 1347 / 0.0 EXTRA SPOROGENOUS CELLS, EXCESS MICROSPOROCYTES1, Leucine-rich repeat transmembrane protein kinase (.1)
PFAM info
Representative CDS sequence
>Lus10010615 pacid=23143647 polypeptide=Lus10010615 locus=Lus10010615.g ID=Lus10010615.BGIv1.0 annot-version=v1.0
ATGAACAGGCTAGGACAGTTACGCCATCCGAATTTGGTTCCATTGTTGGGATTCTGCGCTGTGGAGGAAGAAAGGTTACTCGTTTACAAGCATATAACAG
GCGGGGACTCTGTATTCAACGGAGTTGTGCTTCTCGAATTGGTCACAGGGCAGAAGCCATTGGATGTTGTGAGATTAATGCCGATGAAGCGTTCAAAGGG
AATTTAG
AA sequence
>Lus10010615 pacid=23143647 polypeptide=Lus10010615 locus=Lus10010615.g ID=Lus10010615.BGIv1.0 annot-version=v1.0
MNRLGQLRHPNLVPLLGFCAVEEERLLVYKHITGGDSVFNGVVLLELVTGQKPLDVVRLMPMKRSKGI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G27190 Leucine-rich repeat protein ki... Lus10010615 0 1
AT3G10480 NAC ANAC050 NAC domain containing protein ... Lus10032653 1.4 0.7514
AT4G26690 GDPDL3, GPDL2, ... SHAVEN 3, MUTANT ROOT HAIR 5, ... Lus10043171 3.2 0.7772
AT5G46100 Pentatricopeptide repeat (PPR)... Lus10015397 3.7 0.6629
AT3G52750 FTSZ2-2 Tubulin/FtsZ family protein (.... Lus10022718 4.6 0.7034
AT3G10520 ATGLB2, ARATHGL... NON-SYMBIOTIC HAEMOGLOBIN 2, A... Lus10038655 9.5 0.7447
AT4G20020 unknown protein Lus10037713 10.4 0.6968
AT3G27530 MAG4, GC6 MAIGO 4, golgin candidate 6 (.... Lus10000216 11.3 0.6348
AT3G26330 CYP71B37 "cytochrome P450, family 71, s... Lus10033564 12.0 0.7309
Lus10001343 16.4 0.7200
AT1G50660 unknown protein Lus10002072 17.5 0.7367

Lus10010615 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.