Lus10010636 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G04940 338 / 9e-118 AtTic20-I, atTIC20, TIC20 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
AT1G04945 298 / 1e-97 HIT-type Zinc finger family protein (.1.2.3)
AT4G03320 161 / 3e-48 AtTic20-IV, TIC20-IV translocon at the inner envelope membrane of chloroplasts 20-IV (.1)
AT2G47840 51 / 1e-07 AtTic20-II translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033195 516 / 0 AT1G04940 341 / 7e-119 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
Lus10039783 156 / 2e-46 AT4G03320 263 / 1e-87 translocon at the inner envelope membrane of chloroplasts 20-IV (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G031800 360 / 1e-126 AT1G04940 363 / 1e-127 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
Potri.005G231400 359 / 3e-126 AT1G04940 360 / 2e-126 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
Potri.019G108800 171 / 1e-51 AT4G03320 283 / 2e-95 translocon at the inner envelope membrane of chloroplasts 20-IV (.1)
Potri.013G084900 42 / 0.0001 AT2G47840 196 / 2e-63 translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09685 DUF4870 Domain of unknown function (DUF4870)
Representative CDS sequence
>Lus10010636 pacid=23143650 polypeptide=Lus10010636 locus=Lus10010636.g ID=Lus10010636.BGIv1.0 annot-version=v1.0
ATGATTATACACGGATGCACGTTACCTTCCGGGTATGGAATTATGAATTCCAGGGCAACTCAATTCCCTCATGGTAGATTGGTTTCTGCTCGCATTCCTT
CCAGCGTATCACCATTAACCATTAGGAGTTCTTTGCTGAAGCCCAAATCTTGTTTCTCAATACCGTCATGTGGGTCTTTCCATAACCTCTCTGCTGTATC
TGTACAAGGTGGATTACTACACATGATTCCATATCTACCAAGAAAGCGTGGATCTTATCTCCCTGCTCGGGCTTCCAAGGATGTCCCTTACAGTTTTCGG
TTCCCTCCAATGACAAAAAAGCCAAGGTGGTGGTGGAGGACGCTAGCATGCCTCCCTTATTTGATGCCTTTCCATGAAACCTGGATGTATGCTCAGACAG
CATATAACTTGCACCCCTTCATTGAACAGTTTGAGTATCTTACATACCCGTTCCTCAGAGCTATTGGTAGCTTGCCAGGCTGGTTCTTGATGGCCTATTT
CTTCTGCGCCTATCTTGGAGTTGTCAGGAGAAAGGAATGGCCACATTTCTTCAGATTTCATGTGGTGACAGGAATGTTGCTCGAGATTGCCCTGCAGGTG
GTTGGAACGGTGAGCCGTTGGATGCCACAAGGTTTATACTGGGGGAAGCTTGGGATGCACTTTTGGACGGCCCTGGCATTTGCTCACCTTTTCACTGTCC
TCGAATGCATAAGGTGTGCTATCTGTGGTATGTACGCTGATGTCCCTTTTGTCTCTGATGCTGCATACATTCAGATTCCATATGACTAA
AA sequence
>Lus10010636 pacid=23143650 polypeptide=Lus10010636 locus=Lus10010636.g ID=Lus10010636.BGIv1.0 annot-version=v1.0
MIIHGCTLPSGYGIMNSRATQFPHGRLVSARIPSSVSPLTIRSSLLKPKSCFSIPSCGSFHNLSAVSVQGGLLHMIPYLPRKRGSYLPARASKDVPYSFR
FPPMTKKPRWWWRTLACLPYLMPFHETWMYAQTAYNLHPFIEQFEYLTYPFLRAIGSLPGWFLMAYFFCAYLGVVRRKEWPHFFRFHVVTGMLLEIALQV
VGTVSRWMPQGLYWGKLGMHFWTALAFAHLFTVLECIRCAICGMYADVPFVSDAAYIQIPYD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G04940 AtTic20-I, atTI... translocon at the inner envelo... Lus10010636 0 1
AT1G04940 AtTic20-I, atTI... translocon at the inner envelo... Lus10033195 3.5 0.9269
AT1G16790 ribosomal protein-related (.1) Lus10033346 3.9 0.9296
AT4G38160 PDE191 pigment defective 191, Mitocho... Lus10026571 4.5 0.9441
AT1G68590 Ribosomal protein PSRP-3/Ycf65... Lus10034302 11.2 0.9346
AT5G11450 PPD5 PsbP domain protein 5, Mog1/Ps... Lus10022110 13.6 0.9315
AT3G08920 Rhodanese/Cell cycle control p... Lus10002485 17.0 0.9305
AT2G31840 MRL7-L Mesophyll-cell RNAi Library li... Lus10033475 20.7 0.9010
AT3G21300 RNA methyltransferase family p... Lus10000172 23.7 0.8822
AT3G14110 FLU FLUORESCENT IN BLUE LIGHT, Tet... Lus10015677 24.7 0.9230
AT5G40160 EMB139, EMB506 embryo defective 506, EMBRYO D... Lus10032165 24.7 0.9014

Lus10010636 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.