Plant FIBer expression Database

Lus10010639 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G75350 159 / 5e-51 EMB2184 embryo defective 2184, Ribosomal protein L31 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033200
[exp]
236 / 1e-81 AT1G75350 167 / 4e-54 embryo defective 2184, Ribosomal protein L31 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G033300
[exp]
169 / 5e-55 AT1G75350 178 / 2e-58 embryo defective 2184, Ribosomal protein L31 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01197 Ribosomal_L31 Ribosomal protein L31
Representative CDS sequence
>Lus10010639 pacid=23143631 polypeptide=Lus10010639 locus=Lus10010639.g ID=Lus10010639.BGIv1.0 annot-version=v1.0
ATGGCGCAAACTTTAACCAGCGCTTTCCTCCAATTCAAACCTCTCTCTGCTCCGCCTCTCTCCGCCTCCAAGCCGATGGTTTGCGGCGCAAGAACTAGGA
AAGGAGGGTTTCAGGTGACGTGCCGGAAGAAGGACATACACCCGGAGTTCCACATGGATTCCAAGGTTTACTGCAACGGAGAGCTGGTGATGACTACCGG
CGGCACTCAGAAGGAGTACAACATCGATGTTTGGTCCGGCAACCACCCTTTCTACTTGGGAAACCGTACCGGCGTGCTAGTGGCCGCCGACCAGGTCGAG
AAGTTCCGTAAGAAGTACGGCGAGCTCACCGATTTCATGCAGATTCCTGTCCTCAAAGGCGAGATTGTATTACCTTCCAGGAAGAAATCTATCAAGAAGA
AGAAGTAG
AA sequence
>Lus10010639 pacid=23143631 polypeptide=Lus10010639 locus=Lus10010639.g ID=Lus10010639.BGIv1.0 annot-version=v1.0
MAQTLTSAFLQFKPLSAPPLSASKPMVCGARTRKGGFQVTCRKKDIHPEFHMDSKVYCNGELVMTTGGTQKEYNIDVWSGNHPFYLGNRTGVLVAADQVE
KFRKKYGELTDFMQIPVLKGEIVLPSRKKSIKKKK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G75350 EMB2184 embryo defective 2184, Ribosom... Lus10010639
[exp]
0 1
AT4G34620 SSR16 small subunit ribosomal protei... Lus10027058
[exp]
1.0 0.9886
AT1G75350 EMB2184 embryo defective 2184, Ribosom... Lus10033200
[exp]
1.4 0.9886
AT4G34620 SSR16 small subunit ribosomal protei... Lus10025592
[exp]
1.7 0.9867
AT1G05190 EMB2394 embryo defective 2394, Ribosom... Lus10013041
[exp]
2.8 0.9792
AT5G40950 RPL27 ribosomal protein large subuni... Lus10041553
[exp]
2.8 0.9838
AT5G14910 Heavy metal transport/detoxifi... Lus10014520
[exp]
3.7 0.9819
AT1G05190 EMB2394 embryo defective 2394, Ribosom... Lus10029120
[exp]
3.9 0.9833
AT5G54600 Translation protein SH3-like f... Lus10005180
[exp]
4.2 0.9824
AT1G78630 EMB1473 embryo defective 1473, Ribosom... Lus10041940
[exp]
6.0 0.9785
AT1G79850 PDE347, CS17, P... PLASTID RIBOSOMAL SMALL SUBUNI... Lus10025799
[exp]
6.7 0.9701

Lus10010639 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.