Lus10010663 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10010663 pacid=23141681 polypeptide=Lus10010663 locus=Lus10010663.g ID=Lus10010663.BGIv1.0 annot-version=v1.0
ATGTTGGTGATTTGGAAGGGTGTTTTAGGAAATGTTTTGAATTTTGTAGATGATTTGAAATCAGCTGAAGTATCTATTGCCGTTGTTGCTCTCGCCATTT
GCGACCGGGACAGCAGATTCGCCAGCGGCGAGCTTGGCTCCGGCAATGGAGGCGGCGACCTGTTCGTATGTCTGTCAGTTCGGGGGTCTGGTGGCCCTAC
AGTCCATACCCGTTGTTGTCAGTTTCCTGGACGAAAGGCGGCTGATGTTGTGTTGTTGTTGTTGGAAGTCGTTGGTGGAGTAGCGGCGACAGTGGTGGGT
TGGCGGTGTCGGCGGAGACTTTGCTAA
AA sequence
>Lus10010663 pacid=23141681 polypeptide=Lus10010663 locus=Lus10010663.g ID=Lus10010663.BGIv1.0 annot-version=v1.0
MLVIWKGVLGNVLNFVDDLKSAEVSIAVVALAICDRDSRFASGELGSGNGGGDLFVCLSVRGSGGPTVHTRCCQFPGRKAADVVLLLLEVVGGVAATVVG
WRCRRRLC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10010663 0 1
Lus10002009 2.8 1.0000
AT1G18720 Protein of unknown function (D... Lus10001647 3.0 1.0000
Lus10025056 4.2 1.0000
Lus10002449 4.2 1.0000
AT3G26140 Cellulase (glycosyl hydrolase ... Lus10032312 4.7 1.0000
Lus10006079 4.9 1.0000
AT2G21720 Plant protein of unknown funct... Lus10007431 5.5 1.0000
AT5G42800 M318, TT3, DFR dihydroflavonol 4-reductase (.... Lus10006195 5.5 1.0000
AT5G19580 glyoxal oxidase-related protei... Lus10011111 6.0 1.0000
AT4G28780 GDSL-like Lipase/Acylhydrolase... Lus10023578 7.0 1.0000

Lus10010663 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.