Lus10010669 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G03773 200 / 6e-67 HSP20-like chaperones superfamily protein (.1.2)
AT4G02450 114 / 6e-32 HSP20-like chaperones superfamily protein (.1.2)
AT1G30070 42 / 4e-05 SGS domain-containing protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002623 191 / 3e-63 AT3G03773 165 / 2e-53 HSP20-like chaperones superfamily protein (.1.2)
Lus10020270 197 / 6e-61 AT5G55000 430 / 2e-149 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein (.1.2)
Lus10000340 124 / 3e-35 AT4G02450 120 / 5e-34 HSP20-like chaperones superfamily protein (.1.2)
Lus10024119 119 / 5e-35 AT3G03773 121 / 2e-36 HSP20-like chaperones superfamily protein (.1.2)
Lus10026136 117 / 6e-33 AT4G02450 122 / 1e-34 HSP20-like chaperones superfamily protein (.1.2)
Lus10008680 119 / 1e-32 AT5G04940 216 / 8e-64 SU(VAR)3-9 homolog 1 (.1), SU(VAR)3-9 homolog 1 (.2)
Lus10038500 40 / 0.0003 AT1G30070 290 / 1e-100 SGS domain-containing protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G062600 209 / 2e-70 AT3G03773 191 / 3e-63 HSP20-like chaperones superfamily protein (.1.2)
Potri.019G038550 205 / 8e-69 AT3G03773 197 / 5e-66 HSP20-like chaperones superfamily protein (.1.2)
Potri.002G061500 111 / 2e-31 AT4G02450 123 / 4e-35 HSP20-like chaperones superfamily protein (.1.2)
Potri.005G199700 111 / 3e-31 AT4G02450 127 / 9e-37 HSP20-like chaperones superfamily protein (.1.2)
Potri.011G085100 39 / 0.0005 AT1G30070 285 / 2e-98 SGS domain-containing protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0190 HSP20 PF04969 CS CS domain
Representative CDS sequence
>Lus10010669 pacid=23141672 polypeptide=Lus10010669 locus=Lus10010669.g ID=Lus10010669.BGIv1.0 annot-version=v1.0
ATGGCAGTCGATTACGGTCGAGGAATCAGTCGGAATCCGGAAGTTCTCTGGGCCCAGCGATCCGACAAGGTATACCTGACGGTAGCGTTGCCGGACGCTA
AGGACATATCTGTGAAATGTCAGCCCCAGGGTTTGTTCAGTTTCTCCGCTAGCGGGATTCAGGGCGAGTCCTTCGAGCTCAATCTCCAGCTCTACGCTTC
CATTCTTCCCGAGAAGTGCAAGACTAATGTTGGGTTGAGGAACATAATCTGCTCCATCCAGAAAGAGGAGAAAGGGTGGTGGAGGAGACTGTTGAAATCA
GAAGAGAAGCCTGCACCTTACATTAAAGTTGATTGGCATAGGTGGATCGATGAAGATGATGAAGGACCTGCTTCTGATACACTTTCGGACGACGATGAAG
CTGAGTATGATGAGGACGCTGAAACTAGTGACGATGAAGGACTGCTTTACCTTCCTGATCTAGAGAAGGCGAGGAGAAGCTGA
AA sequence
>Lus10010669 pacid=23141672 polypeptide=Lus10010669 locus=Lus10010669.g ID=Lus10010669.BGIv1.0 annot-version=v1.0
MAVDYGRGISRNPEVLWAQRSDKVYLTVALPDAKDISVKCQPQGLFSFSASGIQGESFELNLQLYASILPEKCKTNVGLRNIICSIQKEEKGWWRRLLKS
EEKPAPYIKVDWHRWIDEDDEGPASDTLSDDDEAEYDEDAETSDDEGLLYLPDLEKARRS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G03773 HSP20-like chaperones superfam... Lus10010669 0 1
AT3G11590 unknown protein Lus10017001 1.7 0.8652
AT1G26160 Metal-dependent phosphohydrola... Lus10035072 2.2 0.8105
AT3G11590 unknown protein Lus10021324 3.2 0.8342
Lus10006886 8.1 0.7775
AT2G23950 Leucine-rich repeat protein ki... Lus10019963 11.5 0.8175
AT5G43140 Peroxisomal membrane 22 kDa (M... Lus10018700 11.8 0.7683
AT4G28600 NPGR2 no pollen germination related ... Lus10023748 16.7 0.7950
AT2G30933 Carbohydrate-binding X8 domain... Lus10007342 18.0 0.7718
AT5G39420 CDC2CAT CDC2C (.1) Lus10005228 18.8 0.8160
AT3G20650 mRNA capping enzyme family pro... Lus10039035 19.0 0.7555

Lus10010669 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.