Lus10010676 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G66030 160 / 1e-46 ATGRIP, GRIP Golgi-localized GRIP domain-containing protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007427 256 / 1e-81 AT5G66030 841 / 0.0 Golgi-localized GRIP domain-containing protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G099800 184 / 3e-55 AT5G66030 735 / 0.0 Golgi-localized GRIP domain-containing protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01465 GRIP GRIP domain
Representative CDS sequence
>Lus10010676 pacid=23141683 polypeptide=Lus10010676 locus=Lus10010676.g ID=Lus10010676.BGIv1.0 annot-version=v1.0
ATGGACTCTTACATCCTTCTCGGCTCTCGCTGGCTTTTGGCAAGACAGCAAGCTCAGAGGGAGGAAGAGCTAGGGCAATCGCAGCGGCATATCTTAGCAC
TTCAAGAAGAGATTGAAGATCTTGAACGGGAAAATCGTCTCCACAACCAACAGGTCTCCATGTTGAAATCCGAGCTCCGAAGCATGGAAAGGACACAGAA
GAGAGAGGGGGTTGACATGACATATCTAAAAAACATCATTGTAAAACTTCTTGAAACAGGTGAGGTGGAAGCGTTGCTCCCTGTTGTTGCTATGCTTCTA
CAATTCAGTCCCGAGGAGGTGCAGAAATGTCGACAAGCATTCCGCACATTGCAGGATGTTCCACCGCAAAATCCTGCTAATGATGCGCCAGGATCTGCTC
TCAACATCCTCTCCAGATTCTCGTTTTCCTGA
AA sequence
>Lus10010676 pacid=23141683 polypeptide=Lus10010676 locus=Lus10010676.g ID=Lus10010676.BGIv1.0 annot-version=v1.0
MDSYILLGSRWLLARQQAQREEELGQSQRHILALQEEIEDLERENRLHNQQVSMLKSELRSMERTQKREGVDMTYLKNIIVKLLETGEVEALLPVVAMLL
QFSPEEVQKCRQAFRTLQDVPPQNPANDAPGSALNILSRFSFS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G66030 ATGRIP, GRIP Golgi-localized GRIP domain-co... Lus10010676 0 1
AT4G30900 DNAse I-like superfamily prote... Lus10022154 1.0 0.8866
AT5G02930 F-box/RNI-like superfamily pro... Lus10029589 4.9 0.8236
AT3G27670 RST1 RESURRECTION1, ARM repeat supe... Lus10013076 5.7 0.8029
AT1G53710 Calcineurin-like metallo-phosp... Lus10042935 5.7 0.7950
AT3G07020 UGT80A2, SGT UDP-glucosyl transferase 80A2,... Lus10022815 6.2 0.8213
AT5G10190 Major facilitator superfamily ... Lus10027265 9.2 0.7654
AT4G33280 B3 REM16 AP2/B3-like transcriptional fa... Lus10025388 12.9 0.6770
AT4G14965 ATMAPR4 membrane-associated progestero... Lus10018026 13.6 0.7994
AT1G53710 Calcineurin-like metallo-phosp... Lus10042936 13.7 0.7906
Lus10042808 14.4 0.7660

Lus10010676 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.