Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G31830 136 / 2e-43 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022159 [exp] 67 / 6e-16 AT4G31830 59 / 3e-13 unknown protein Lus10036258 [exp] 62 / 6e-14 AT4G31830 55 / 2e-11 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G018300 [exp] 134 / 2e-42 AT4G31830 114 / 3e-34 unknown protein Potri.006G183800 [exp] 77 / 5e-20 AT4G31830 56 / 8e-12 unknown protein Potri.018G106300 [exp] 69 / 5e-17 AT4G31830 61 / 6e-14 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010682 pacid=23141688 polypeptide=Lus10010682 locus=Lus10010682.g ID=Lus10010682.BGIv1.0 annot-version=v1.0 ATGGGGGGAGGTGAAGGAGGAGATCAGTGGAGGAAGCAAGCAGACACTCATAAGATGAGTTCCGAAGAAGTGAAAGCAGCCGGTCTTGAAGGCTCCAGGC GCCCTCCTGGACACAATCCAGGGGAAGTGCTTCACCAGCGCAGCAAACTGCCGTTCAGCACAACCACCATGGCTGTCACCGGATTCCTTATTACGGCGGC AGTTGGATACATGGTTCTTTATTCCAAGAAGAAGCCTGAAGCTGACGCCCTTGATGTCGCTAAGGTTGCTACTAATACTGCCCACCCCCGCGATACTCAC CCTCGCAAATAA
AA sequence Show only first row Show all	>Lus10010682 pacid=23141688 polypeptide=Lus10010682 locus=Lus10010682.g ID=Lus10010682.BGIv1.0 annot-version=v1.0 MGGGEGGDQWRKQADTHKMSSEEVKAAGLEGSRRPPGHNPGEVLHQRSKLPFSTTTMAVTGFLITAAVGYMVLYSKKKPEADALDVAKVATNTAHPRDTH PRK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G31830			unknown protein		Lus10010682 [exp]	0	1
AT1G12110		CHL1-1, CHL1, B...	CHLORINA 1, ARABIDOPSIS THALIA...		Lus10024614 [exp]	2.8	0.9547
AT5G49525			unknown protein		Lus10017078 [exp]	5.7	0.9469
AT4G39780	AP2_ERF		Integrase-type DNA-binding sup...		Lus10019665 [exp]	6.5	0.9483
AT1G21890			nodulin MtN21 /EamA-like trans...		Lus10021201 [exp]	9.8	0.9156
AT4G39780	AP2_ERF		Integrase-type DNA-binding sup...		Lus10000582 [exp]	10.2	0.9216
AT1G11310		PMR2, ATMLO2, M...	POWDERY MILDEW RESISTANT 2, MI...		Lus10011630 [exp]	12.4	0.9245
AT3G14280			unknown protein		Lus10003937 [exp]	13.1	0.9079
AT1G56580		SVB	SMALLER WITH VARIABLE BRANCHES...		Lus10000354 [exp]	15.4	0.8751
AT4G18220			Drug/metabolite transporter su...		Lus10043396 [exp]	16.7	0.9254
AT5G18670		BAM9, BMY3	BETA-AMYLASE 9, beta-amylase 3...		Lus10012804 [exp]	18.3	0.9081

Compare expression of checked genes

Lus10010682 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.