Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G24020 56 / 7e-11 MLP423 MLP-like protein 423 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029182 [exp] 131 / 7e-38 AT1G24020 88 / 1e-20 MLP-like protein 423 (.1.2) Lus10010698 [exp] 130 / 3e-37 AT1G24020 94 / 2e-22 MLP-like protein 423 (.1.2) Lus10029184 [exp] 120 / 4e-33 AT1G24020 84 / 1e-18 MLP-like protein 423 (.1.2) Lus10029186 [exp] 107 / 2e-28 AT1G24020 78 / 2e-16 MLP-like protein 423 (.1.2) Lus10010702 [exp] 93 / 2e-23 AT1G24020 79 / 4e-17 MLP-like protein 423 (.1.2) Lus10010700 [exp] 59 / 5e-12 AT1G24020 74 / 4e-17 MLP-like protein 423 (.1.2) Lus10010701 [exp] 59 / 8e-12 AT1G24020 80 / 3e-19 MLP-like protein 423 (.1.2) Lus10003451 [exp] 58 / 1e-11 AT1G24020 73 / 7e-17 MLP-like protein 423 (.1.2) Lus10029185 [exp] 57 / 2e-11 AT1G24020 80 / 2e-19 MLP-like protein 423 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G096000 [exp] 53 / 5e-10 AT1G24020 188 / 3e-62 MLP-like protein 423 (.1.2) Potri.011G025966 [exp] 47 / 8e-08 AT1G24020 55 / 7e-10 MLP-like protein 423 (.1.2) Potri.011G025900 [exp] 47 / 8e-08 AT1G24020 55 / 7e-10 MLP-like protein 423 (.1.2) Potri.011G026100 [exp] 47 / 1e-07 AT1G24020 54 / 2e-09 MLP-like protein 423 (.1.2) Potri.008G213223 [exp] 46 / 2e-07 AT1G24020 64 / 6e-14 MLP-like protein 423 (.1.2) Potri.011G026200 [exp] 44 / 1e-06 AT1G24020 52 / 1e-08 MLP-like protein 423 (.1.2) Potri.008G212100 [exp] 44 / 1e-06 AT1G24020 50 / 6e-08 MLP-like protein 423 (.1.2) Potri.008G212700 [exp] 44 / 1e-06 AT1G24020 68 / 8e-15 MLP-like protein 423 (.1.2) Potri.008G213446 [exp] 44 / 1e-06 AT1G24020 68 / 8e-15 MLP-like protein 423 (.1.2) Potri.008G213669 [exp] 44 / 1e-06 AT1G24020 68 / 8e-15 MLP-like protein 423 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [flax] [poplar] Bet_v_1_like PF00407 [flax] [poplar] Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence Show only first row Show all	>Lus10010699 pacid=23148724 polypeptide=Lus10010699 locus=Lus10010699.g ID=Lus10010699.BGIv1.0 annot-version=v1.0 ATGCGACTCGAGCTTCTAACATTGATTTTGAACTCCCTCCTTTTTTGGCTGTGTACGTTAAACTACAGTGATCAAGTGGCTTTCAATATCATCTCATCTG CAGAAAAATTATGGGGAGCCTTCTTTGCATCCACAAAAATACTGCCAAAAGCGTTACCTCAAGCATTCAAATCTATCAAAATAATGAGGGGCGACGGGTT CAGGAAAGGCTCGATCCGGGAGATTTCCTTTGCACAAGGTGACATCGAGAAGTTGGAGGAGAAGATAGCACACGTGGATCAAGAGACGAAGACGATAACA TAG
AA sequence Show only first row Show all	>Lus10010699 pacid=23148724 polypeptide=Lus10010699 locus=Lus10010699.g ID=Lus10010699.BGIv1.0 annot-version=v1.0 MRLELLTLILNSLLFWLCTLNYSDQVAFNIISSAEKLWGAFFASTKILPKALPQAFKSIKIMRGDGFRKGSIREISFAQGDIEKLEEKIAHVDQETKTIT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10010699 [exp]	0	1
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10002613 [exp]	1.0	0.9220
AT5G58840			Subtilase family protein (.1)		Lus10016483 [exp]	3.5	0.7563
AT5G44230			Pentatricopeptide repeat (PPR)...		Lus10025982 [exp]	6.2	0.7286
					Lus10000400 [exp]	8.4	0.8069
AT2G29110		ATGLR2.8	glutamate receptor 2.8 (.1)		Lus10026877 [exp]	10.2	0.8069
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10029390 [exp]	11.8	0.8069
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10029913 [exp]	13.2	0.8069
AT5G18460			Protein of Unknown Function (D...		Lus10006860 [exp]	14.5	0.8069
					Lus10009372 [exp]	15.7	0.8069
AT4G29280		LCR22	low-molecular-weight cysteine-...		Lus10015983 [exp]	16.7	0.8069

Compare expression of checked genes

Lus10010699 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.