Plant FIBer expression Database

Lus10010705 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G24050 106 / 6e-30 RNA-processing, Lsm domain (.1)
AT1G70220 78 / 2e-18 RNA-processing, Lsm domain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029189
[exp]
82 / 7e-22 ND 35 / 0.002
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G095601
[exp]
125 / 3e-37 AT1G24050 166 / 1e-52 RNA-processing, Lsm domain (.1)
Potri.008G146200
[exp]
125 / 3e-37 AT1G24050 167 / 5e-53 RNA-processing, Lsm domain (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09793 AD Anticodon-binding domain
Representative CDS sequence
>Lus10010705 pacid=23148701 polypeptide=Lus10010705 locus=Lus10010705.g ID=Lus10010705.BGIv1.0 annot-version=v1.0
ATGGAAGGTAGCAACATCAGCAGCGAGGACTTCGCAGTTGGCTGCTTGCTGTCCATCAAAACCACCTTAGGAGAAGAATTCGAAGGCCAAGTCATCACCT
TCGACCGTCCTTCCAACATCCTCGCTCGTGAGGAATTGGCTCTCAGGCAAGCAGAAGCAGATGCTCAAAGGATTGGTGTTGGTGTCACTGTTGAGGCTCA
GGGAATCTATGATGCCTTATCTAAGACGCTTCCGGTCCGCTGGGACAAGACGTCTATAGTTGTGATGAATGAAGTCCGTGTTAGCAGTCCGTATCTGGCC
GAAAATGTTACTGGAGGAACTGCTGCTGCCAATGACCGAGTGAAGAAAGTGCTTGAATTGGAGAGGAGGAGGTTGCAAACTCGCGTCCCTGGTCAGTGA
AA sequence
>Lus10010705 pacid=23148701 polypeptide=Lus10010705 locus=Lus10010705.g ID=Lus10010705.BGIv1.0 annot-version=v1.0
MEGSNISSEDFAVGCLLSIKTTLGEEFEGQVITFDRPSNILAREELALRQAEADAQRIGVGVTVEAQGIYDALSKTLPVRWDKTSIVVMNEVRVSSPYLA
ENVTGGTAAANDRVKKVLELERRRLQTRVPGQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G24050 RNA-processing, Lsm domain (.1... Lus10010705
[exp]
0 1
AT3G25120 Mitochondrial import inner mem... Lus10013127
[exp]
2.6 0.8958
AT3G04780 Protein of unknown function (D... Lus10020246
[exp]
3.5 0.8814
AT2G43320 S-adenosyl-L-methionine-depend... Lus10015953
[exp]
7.1 0.9175
AT4G12790 P-loop containing nucleoside t... Lus10036411
[exp]
7.3 0.9135
AT2G32080 PUR ALPHA-1, PU... purin-rich alpha 1 (.1.2) Lus10001782
[exp]
7.7 0.9086
AT5G53530 VPS26A vacuolar protein sorting 26A (... Lus10023242
[exp]
7.7 0.9004
AT5G16870 Peptidyl-tRNA hydrolase II (PT... Lus10009246
[exp]
8.0 0.9045
AT3G18820 RAB71, AtRABG3f... RAB GTPase homolog G3F (.1) Lus10040468
[exp]
8.5 0.8974
AT5G16950 unknown protein Lus10021093
[exp]
9.0 0.8866
AT5G28050 Cytidine/deoxycytidylate deami... Lus10015942
[exp]
11.4 0.8806

Lus10010705 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.