Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38840 105 / 7e-31 SAUR-like auxin-responsive protein family (.1) AT5G18020 102 / 5e-30 SAUR-like auxin-responsive protein family (.1) AT5G18080 102 / 6e-30 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT5G18060 101 / 2e-29 SAUR-like auxin-responsive protein family (.1) AT5G18050 100 / 2e-29 SAUR-like auxin-responsive protein family (.1) AT2G21200 100 / 8e-29 SAUR-like auxin-responsive protein family (.1) AT5G18030 99 / 1e-28 SAUR-like auxin-responsive protein family (.1) AT5G18010 99 / 1e-28 SAUR19, SAUR24 small auxin up RNA 19, SAUR-like auxin-responsive protein family (.1) AT2G21210 98 / 4e-28 SAUR-like auxin-responsive protein family (.1) AT4G38825 97 / 6e-28 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029198 [exp] 158 / 6e-52 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10008999 [exp] 138 / 6e-44 AT4G38840 117 / 7e-36 SAUR-like auxin-responsive protein family (.1) Lus10025909 [exp] 136 / 4e-43 AT4G34770 116 / 3e-35 SAUR-like auxin-responsive protein family (.1) Lus10009628 [exp] 134 / 2e-42 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10009623 [exp] 134 / 2e-42 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10008995 [exp] 134 / 2e-42 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10008991 [exp] 134 / 3e-42 AT4G38840 115 / 4e-35 SAUR-like auxin-responsive protein family (.1) Lus10009624 [exp] 132 / 1e-41 AT4G38840 119 / 9e-37 SAUR-like auxin-responsive protein family (.1) Lus10025911 [exp] 132 / 1e-41 AT4G38840 118 / 4e-36 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G126700 [exp] 124 / 2e-38 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.009G126300 [exp] 122 / 8e-38 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126500 [exp] 119 / 1e-36 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 115 / 4e-35 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 113 / 3e-34 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126400 [exp] 110 / 6e-33 AT5G18020 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Potri.004G164600 [exp] 108 / 2e-32 AT4G38840 115 / 5e-35 SAUR-like auxin-responsive protein family (.1) Potri.009G126900 [exp] 108 / 4e-32 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1) Potri.004G165450 [exp] 103 / 2e-30 AT4G38840 129 / 2e-40 SAUR-like auxin-responsive protein family (.1) Potri.004G165300 [exp] 102 / 5e-30 AT4G38840 130 / 6e-41 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10010713 pacid=23148706 polypeptide=Lus10010713 locus=Lus10010713.g ID=Lus10010713.BGIv1.0 annot-version=v1.0 ATGGCTATTGGGTTGCCTGGTAGCTTAGCCAAGCAGATTCTCCGAAGAACCGGCTCCGGATCGAGCAGAACATCATCATCCTCGAGGTTTCAAGATGTGC CAAAGGGGTTCTTAGCAGTATACGTCGGAGGAGAAACACAGAAGAAGAGATTCATCGTACCGGTGTCCTACTTAAACCAGCCATCATTTCAGGATTTGTT GATGATGGCTGAAGAGGAATTCGGGTTTAAGCATTCCATGGGTGCATTGACCATTCCTTGCAGTCAAGAGATTTTTGTTTCTGTTACTTCAAGCTTGAGC AGACCATGA
AA sequence Show only first row Show all	>Lus10010713 pacid=23148706 polypeptide=Lus10010713 locus=Lus10010713.g ID=Lus10010713.BGIv1.0 annot-version=v1.0 MAIGLPGSLAKQILRRTGSGSSRTSSSSRFQDVPKGFLAVYVGGETQKKRFIVPVSYLNQPSFQDLLMMAEEEFGFKHSMGALTIPCSQEIFVSVTSSLS RP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G38840			SAUR-like auxin-responsive pro...		Lus10010713 [exp]	0	1
					Lus10021443 [exp]	1.7	0.8307
AT5G26620			unknown protein		Lus10031447 [exp]	2.2	0.8154
AT4G34770			SAUR-like auxin-responsive pro...		Lus10038192 [exp]	3.2	0.8552
AT5G02890			HXXXD-type acyl-transferase fa...		Lus10040156 [exp]	6.8	0.8354
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009000 [exp]	10.4	0.8154
AT3G24140	bHLH	bHLH097, FMA	FAMA, basic helix-loop-helix (...		Lus10016680 [exp]	11.5	0.8134
AT3G05880		RCI2A	RARE-COLD-INDUCIBLE 2A, Low te...		Lus10014028 [exp]	14.3	0.7882
AT5G18050			SAUR-like auxin-responsive pro...		Lus10008994 [exp]	15.4	0.8018
AT1G62300	WRKY	ATWRKY6, WRKY6	WRKY family transcription fact...		Lus10022959 [exp]	18.3	0.7050
AT4G34770			SAUR-like auxin-responsive pro...		Lus10025909 [exp]	19.9	0.7891

Compare expression of checked genes

Lus10010713 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.