Lus10010735 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G69970 64 / 2e-14 CLE26 CLAVATA3/ESR-RELATED 26 (.1.2)
AT3G28455 47 / 4e-08 CLE25 CLAVATA3/ESR-RELATED 25 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039460 47 / 7e-08 AT3G28455 56 / 5e-12 CLAVATA3/ESR-RELATED 25 (.1)
Lus10005836 39 / 0.0002 AT3G28455 49 / 3e-08 CLAVATA3/ESR-RELATED 25 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G039800 77 / 3e-19 AT1G69970 72 / 8e-18 CLAVATA3/ESR-RELATED 26 (.1.2)
Potri.008G191500 66 / 7e-15 AT1G69970 64 / 2e-14 CLAVATA3/ESR-RELATED 26 (.1.2)
Potri.017G074600 50 / 4e-09 AT3G28455 67 / 3e-16 CLAVATA3/ESR-RELATED 25 (.1)
PFAM info
Representative CDS sequence
>Lus10010735 pacid=23148703 polypeptide=Lus10010735 locus=Lus10010735.g ID=Lus10010735.BGIv1.0 annot-version=v1.0
ATGGGAAGAAGTAGTACTAAACCATCCATAGTGTGGTTGGTGTGGCTTTTGCTCGTTGGTTTGTTTGAGTTGGAAGTCATACTAAGTTCAAGTGTCTCAA
GAGCGAACGCCATGTCATCATCCACATCCACATCGACCGCCACCTCGAGGAGAAGGGTAGTAGTGACCATGAAGGTTCAGCCTCCGTCGACGACTATGGC
CACCGTCGATGAGGAGGCTGTGGTTGAAAAAGACGACATCAAGGTAGTTGGGAAAAGTCTCGATGAGTTGAATTACATGATGAGCAAAAGAAGAGTTCCA
AACGGTCCTGATCCCATCCATAACAGGAGAGCTGGGAACTCTAAACGGCCGCCTGGACGGGCTTAG
AA sequence
>Lus10010735 pacid=23148703 polypeptide=Lus10010735 locus=Lus10010735.g ID=Lus10010735.BGIv1.0 annot-version=v1.0
MGRSSTKPSIVWLVWLLLVGLFELEVILSSSVSRANAMSSSTSTSTATSRRRVVVTMKVQPPSTTMATVDEEAVVEKDDIKVVGKSLDELNYMMSKRRVP
NGPDPIHNRRAGNSKRPPGRA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G69970 CLE26 CLAVATA3/ESR-RELATED 26 (.1.2) Lus10010735 0 1
AT4G10790 UBX domain-containing protein ... Lus10027684 2.0 0.9582
AT2G18196 Heavy metal transport/detoxifi... Lus10008284 2.4 0.9543
AT3G45070 P-loop containing nucleoside t... Lus10003070 4.9 0.9538
AT5G64240 AtMCP1a, ATMC3 metacaspase 1a, metacaspase 3 ... Lus10035630 4.9 0.9505
AT1G35470 SPla/RYanodine receptor (SPRY)... Lus10020190 4.9 0.9542
AT5G66900 Disease resistance protein (CC... Lus10020779 5.3 0.9496
AT5G17770 CBR1, ATCBR NADH:cytochrome B5 reductase 1... Lus10033405 5.9 0.9533
AT5G02070 Protein kinase family protein ... Lus10014387 7.3 0.9257
Lus10017954 7.4 0.9346
AT2G17700 STY8 serine/threonine/tyrosine kina... Lus10004153 7.7 0.9406

Lus10010735 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.