Lus10010742 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037239 59 / 8e-11 AT5G09650 446 / 1e-159 pyrophosphorylase 6 (.1)
Lus10035653 58 / 4e-10 AT5G09650 446 / 2e-159 pyrophosphorylase 6 (.1)
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04554 Extensin_2 Extensin-like region
Representative CDS sequence
>Lus10010742 pacid=23148754 polypeptide=Lus10010742 locus=Lus10010742.g ID=Lus10010742.BGIv1.0 annot-version=v1.0
ATGGCGACGGCGGTAAGAGCACTGGCGGCTGCGGCCAACACGGCCACCCCAGCTTCTTGCTTACGGCCATTCGCTTACAAATCAAGGCAGAGCCTTCGTT
TCAGCAAGAAACACTTGTCTTTTTCGCTGGCGAAGAGGTTTCTCCTTACGCCAATAAAACCATACAATTATAAATCTCCACCCCCACCTCCGACTCCGGT
GTACAAGTACAAGTCGCCACCGCCACCGGTGTACAAGTCACCACCACCACCCACGCCGATGTACAAATACAAATCACCGCCTCCACCAGTGTACAAGTCA
CCACCACCACCAACTCCGGTTTACAAGTACAAGTCACCACCGCCACCGGTGTACAAGTCGCCTCCTCCACCAACAAAGCCATACAAGTACAAGTCTCCAC
CACCACCACCGGTCTATAAGTCACCACCGCCACCGGTTTACAAGTACAAGTCACCGCCGCCGCCGGTGCACAAGCCACCTCCGCATTACATCTATGCTTC
ACCTCCTCCACCACACCACGTCTAG
AA sequence
>Lus10010742 pacid=23148754 polypeptide=Lus10010742 locus=Lus10010742.g ID=Lus10010742.BGIv1.0 annot-version=v1.0
MATAVRALAAAANTATPASCLRPFAYKSRQSLRFSKKHLSFSLAKRFLLTPIKPYNYKSPPPPPTPVYKYKSPPPPVYKSPPPPTPMYKYKSPPPPVYKS
PPPPTPVYKYKSPPPPVYKSPPPPTKPYKYKSPPPPPVYKSPPPPVYKYKSPPPPVHKPPPHYIYASPPPPHHV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10010742 0 1
AT5G40010 ASD, AATP1 ATPase-in-Seed-Development, AA... Lus10032188 2.8 0.8751
Lus10028589 5.1 0.9172
AT1G23820 SPDS1 spermidine synthase 1 (.1.2) Lus10030861 7.1 0.8613
AT1G22360 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 ... Lus10013653 8.7 0.7841
AT1G70310 SPDS2 spermidine synthase 2 (.1) Lus10030629 13.2 0.8517
AT2G15480 UGT73B5 UDP-glucosyl transferase 73B5 ... Lus10019835 13.3 0.7792
AT1G02000 GAE2 UDP-D-glucuronate 4-epimerase ... Lus10023077 14.5 0.8192
AT1G77760 GNR1, NIA1 nitrate reductase 1 (.1) Lus10038977 19.7 0.8556
AT5G08380 ATAGAL1 alpha-galactosidase 1 (.1) Lus10017365 22.6 0.8428
AT2G31800 Integrin-linked protein kinase... Lus10007432 22.9 0.8037

Lus10010742 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.