Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G64530 201 / 4e-66 NAC ANAC104, XND1 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) AT1G61110 100 / 1e-25 NAC ANAC025 NAC domain containing protein 25 (.1) AT1G52890 95 / 2e-23 NAC ANAC019 NAC domain containing protein 19 (.1) AT4G27410 94 / 4e-23 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT3G15500 93 / 7e-23 NAC ATNAC3, ANAC055 NAC domain containing protein 55, NAC domain containing protein 3 (.1) AT3G15510 94 / 1e-22 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) AT1G69490 89 / 1e-21 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) AT3G04070 90 / 3e-21 NAC ANAC047 NAC domain containing protein 47 (.1.2) AT1G01720 88 / 4e-21 NAC ATAF1, ANAC002 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT1G77450 85 / 3e-20 NAC ANAC032 NAC domain containing protein 32 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000206 [exp] 274 / 9e-95 AT5G64530 264 / 5e-91 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Lus10035648 [exp] 274 / 9e-95 AT5G64530 264 / 5e-91 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Lus10035647 [exp] 274 / 9e-95 AT5G64530 264 / 5e-91 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Lus10011215 [exp] 112 / 1e-29 AT1G61110 305 / 1e-102 NAC domain containing protein 25 (.1) Lus10018469 [exp] 110 / 8e-29 AT1G61110 301 / 5e-101 NAC domain containing protein 25 (.1) Lus10032657 [exp] 105 / 7e-27 AT3G15510 353 / 1e-120 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10043095 [exp] 105 / 1e-26 AT3G15510 351 / 1e-119 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10006547 [exp] 97 / 9e-24 AT3G04070 337 / 4e-114 NAC domain containing protein 47 (.1.2) Lus10023179 [exp] 96 / 2e-23 AT1G61110 248 / 2e-80 NAC domain containing protein 25 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G022800 [exp] 179 / 1e-57 AT5G64530 231 / 5e-78 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Potri.001G206900 [exp] 176 / 2e-56 AT5G64530 221 / 2e-74 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Potri.007G105000 [exp] 157 / 8e-49 AT5G64530 183 / 3e-59 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Potri.005G064100 [exp] 149 / 2e-45 AT5G64530 199 / 3e-65 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Potri.004G038000 [exp] 105 / 5e-27 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1) Potri.001G404400 [exp] 104 / 8e-27 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.011G123500 [exp] 102 / 9e-26 AT3G15510 323 / 4e-109 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.011G046700 [exp] 100 / 5e-25 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1) Potri.002G081000 [exp] 93 / 8e-23 AT1G01720 416 / 5e-148 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.011G123300 [exp] 93 / 2e-22 AT4G27410 354 / 2e-122 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10010747 pacid=23148762 polypeptide=Lus10010747 locus=Lus10010747.g ID=Lus10010747.BGIv1.0 annot-version=v1.0 ATGAACTTGCCTCCTGGTTTCCGATTCTACCCAACTGACGAGGAGCTCGTAGTCCACTTCCTCCATCGCAAAGCTACCCTTTTGCCATGCCACCCTGACG TCATCCCTGATCTCGACCTCTACCCTTACGATCCTTGGGACCTCCATGGCAAGGCGTTGGAAGAAGGGAATCAGTGGTACTTCTACAGCAGGAAAACTCT GAACCGGGTTACCGATAATGGGCTTTGGAAAACCATAGGCATGGAGGAGCCTATCATTTCATCAAGTGGCAACAACAGGAGGGTTGGAGTAAAGAAGTAT TTGATGTTCTTCTTGGGGGGAGATGTCAAAACTAACTGGATCATGGAGGAGTTTCGTCTCCCTGATTCCTCCTCTACTACCACTGGGACCAGTTCTAGTA CCAGTCGGTCGTCCAGAAGTACACGATCACGGTCCAGACCGGACTACAACAAGTGGGTAGTTTGCAGAGTGTATGAGCGAAACTCGAGTGACGATGACGA GGATGGGTCGACGGGGCTGTCATGCTTGGATGAAGTGTTCCTGTCGTTGGATGATCTTGACGACATTAGTTTGCCTTATAATTAA
AA sequence Show only first row Show all	>Lus10010747 pacid=23148762 polypeptide=Lus10010747 locus=Lus10010747.g ID=Lus10010747.BGIv1.0 annot-version=v1.0 MNLPPGFRFYPTDEELVVHFLHRKATLLPCHPDVIPDLDLYPYDPWDLHGKALEEGNQWYFYSRKTLNRVTDNGLWKTIGMEEPIISSSGNNRRVGVKKY LMFFLGGDVKTNWIMEEFRLPDSSSTTTGTSSSTSRSSRSTRSRSRPDYNKWVVCRVYERNSSDDDEDGSTGLSCLDEVFLSLDDLDDISLPYN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G64530	NAC	ANAC104, XND1	Arabidopsis NAC domain contain...		Lus10010747 [exp]	0	1
AT5G65110		ATACX2, ACX2	acyl-CoA oxidase 2 (.1.2)		Lus10024038 [exp]	5.2	0.9464
AT4G37870		PCK1, PEPCK	phosphoenolpyruvate carboxykin...		Lus10028227 [exp]	6.9	0.9511
AT5G41761			unknown protein		Lus10012634 [exp]	7.2	0.9427
AT1G60010			unknown protein		Lus10030835 [exp]	8.6	0.9468
AT4G33495		RPD1	ROOT PRIMORDIUM DEFECTIVE 1, U...		Lus10005755 [exp]	10.6	0.9291
AT1G75810			unknown protein		Lus10034536 [exp]	11.2	0.9239
AT5G24560		ATPP2-B12	phloem protein 2-B12 (.1)		Lus10008898 [exp]	13.0	0.9347
					Lus10031312 [exp]	14.1	0.9237
AT1G15190			Fasciclin-like arabinogalactan...		Lus10003958 [exp]	14.4	0.9003
					Lus10035913 [exp]	15.1	0.9034

Compare expression of checked genes

Lus10010747 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.