Lus10010753 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G09620 181 / 2e-55 Octicosapeptide/Phox/Bem1p family protein (.1)
AT5G64430 167 / 3e-50 Octicosapeptide/Phox/Bem1p family protein (.1)
AT2G01190 116 / 7e-31 PDE331 PIGMENT DEFECTIVE 331, Octicosapeptide/Phox/Bem1p family protein (.1)
AT4G05150 106 / 7e-28 Octicosapeptide/Phox/Bem1p family protein (.1)
AT5G49920 96 / 1e-24 Octicosapeptide/Phox/Bem1p family protein (.1)
AT1G70640 91 / 6e-24 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (.1)
AT2G35050 93 / 1e-22 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT3G26510 89 / 1e-22 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
AT5G57610 92 / 3e-22 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT3G46920 88 / 4e-21 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035641 229 / 8e-78 AT5G09620 243 / 6e-78 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10042925 164 / 3e-49 AT5G09620 236 / 7e-72 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10018412 108 / 3e-28 AT4G05150 304 / 1e-98 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10002588 106 / 9e-28 AT4G05150 319 / 2e-104 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10034643 97 / 8e-25 AT2G01190 186 / 1e-53 PIGMENT DEFECTIVE 331, Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10007952 99 / 9e-25 AT2G01190 444 / 1e-146 PIGMENT DEFECTIVE 331, Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10013495 92 / 2e-22 AT2G01190 176 / 1e-46 PIGMENT DEFECTIVE 331, Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10025941 91 / 7e-22 AT3G24715 424 / 2e-129 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Lus10038159 91 / 7e-22 AT3G24715 229 / 4e-62 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G080200 194 / 1e-60 AT5G64430 281 / 6e-89 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.001G285800 189 / 6e-59 AT5G64430 270 / 8e-85 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.002G108800 130 / 5e-37 AT5G09620 146 / 3e-39 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.004G032200 118 / 2e-32 AT4G05150 333 / 1e-110 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.011G041100 116 / 1e-31 AT4G05150 297 / 4e-96 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.010G119500 105 / 4e-27 AT2G01190 388 / 1e-124 PIGMENT DEFECTIVE 331, Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.012G053500 100 / 2e-25 AT3G18230 298 / 6e-92 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.008G124700 99 / 6e-25 AT2G01190 430 / 3e-141 PIGMENT DEFECTIVE 331, Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.008G186500 94 / 1e-24 AT3G26510 152 / 1e-46 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Potri.001G052000 97 / 4e-24 AT1G04700 721 / 0.0 PB1 domain-containing protein tyrosine kinase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00564 PB1 PB1 domain
Representative CDS sequence
>Lus10010753 pacid=23148715 polypeptide=Lus10010753 locus=Lus10010753.g ID=Lus10010753.BGIv1.0 annot-version=v1.0
ATGGAAAGCTACTCCTACAACTCCTCCTACCCTGATTCAGGCCACTCCTCCCCTCGATCCCGCGAAATCGACTTCGAAAACCCTCCCCCATGGGAGGACC
AGTCTTCCTCCTCCTCCCTCAACTCCGCCAAGGTCAAGTTCCTGTGCAGCTACGGCGGAAAGATCCACCCTCGCCCCCACGACAACCAGCTCGCCTACAT
CGGCGGCGACACCAAGATCCTCTCCGTTGACCGCAACATCAAGTTCTCCTCCCTCATCTCCAAGCTCTCCGCTCTCTCCGGCGACGGCGTCGACATGTCC
TTCAAGTACCAGCTCCCCGGTGAGGATCTCGACGCCTTGATCTCCGTCACCAACGACGACGACCTCGAGCACCCGGGGCACCAGCGTCACCGACCCCGCT
CGCCAGTCTCGCGCCTCCGCTAA
AA sequence
>Lus10010753 pacid=23148715 polypeptide=Lus10010753 locus=Lus10010753.g ID=Lus10010753.BGIv1.0 annot-version=v1.0
MESYSYNSSYPDSGHSSPRSREIDFENPPPWEDQSSSSSLNSAKVKFLCSYGGKIHPRPHDNQLAYIGGDTKILSVDRNIKFSSLISKLSALSGDGVDMS
FKYQLPGEDLDALISVTNDDDLEHPGHQRHRPRSPVSRLR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G09620 Octicosapeptide/Phox/Bem1p fam... Lus10010753 0 1
AT5G64430 Octicosapeptide/Phox/Bem1p fam... Lus10010752 1.0 0.9315
AT4G13510 ATAMT1;1, AMT1;... ARABIDOPSIS THALIANA AMMONIUM ... Lus10023705 3.2 0.8782
AT5G21090 Leucine-rich repeat (LRR) fami... Lus10000196 6.0 0.8458
AT5G11810 unknown protein Lus10022300 7.3 0.8386
AT1G73500 ATMKK9 MAP kinase kinase 9 (.1) Lus10040127 8.5 0.8371
AT4G18700 ATWL4, CIPK12, ... SNF1-RELATED PROTEIN KINASE 3.... Lus10029231 15.5 0.8271
AT3G02510 Regulator of chromosome conden... Lus10017581 16.1 0.8112
AT4G10265 Wound-responsive family protei... Lus10039754 16.7 0.8100
AT4G19950 unknown protein Lus10038358 17.2 0.8328
AT2G46620 P-loop containing nucleoside t... Lus10030220 17.2 0.8454

Lus10010753 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.