Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12510 62 / 4e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 62 / 4e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12480 58 / 2e-11 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G62510 56 / 1e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12500 53 / 2e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G45180 52 / 2e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 52 / 4e-09 AZI1 azelaic acid induced 1 (.1) AT4G12545 48 / 5e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12490 49 / 6e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G12090 48 / 8e-08 ELP extensin-like protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035629 [exp] 150 / 5e-48 AT4G12520 95 / 3e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028928 [exp] 72 / 2e-17 AT4G12520 105 / 3e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004347 [exp] 69 / 4e-16 AT4G12520 101 / 7e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032259 [exp] 63 / 1e-13 AT4G12520 133 / 2e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024626 [exp] 57 / 3e-11 AT4G12520 157 / 7e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10001493 [exp] 56 / 5e-11 AT1G62510 111 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032261 [exp] 56 / 6e-11 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1) Lus10024627 [exp] 54 / 6e-10 AT4G12520 136 / 3e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032263 [exp] 53 / 9e-10 AT4G12520 135 / 9e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G158400 [exp] 64 / 7e-14 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 56 / 1e-10 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 55 / 2e-10 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121800 [exp] 49 / 3e-08 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 48 / 5e-08 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 42 / 9e-06 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G059800 [exp] 40 / 9e-05 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10010765 pacid=23148728 polypeptide=Lus10010765 locus=Lus10010765.g ID=Lus10010765.BGIv1.0 annot-version=v1.0 ATGGCATCTTCCAGAACCGACTCATCAGTGTCCCTTCTTGGCGCCGTCTTCCTCGCCGTCAACCTTCTGATCTTCTTCTCTCCCGGTGCCGCAGCCACCG GCACGTGTCCGTATGATCCAAGCAAGTTAAGCGTCTGCGCCACTCTGCTGGACTCGCTGATCCACGTTTACGCTGGAACCCAGCCGCCGGCCGAGCCATG TTGCAGCGTGGTATGTGGGGTCAGCGCCGACATTGACGCCGCCATTTGTGCTTGTGCCGCCCTTAAAGCCAATGTTCTTGGGGTTAATCTCGACCTTAAC GTCTCTCTCCAGTTGCTCCTCCAGAAATGTGGCAAGCAGGTTCCGTCTGGCTATGTCTGCGTTTAG
AA sequence Show only first row Show all	>Lus10010765 pacid=23148728 polypeptide=Lus10010765 locus=Lus10010765.g ID=Lus10010765.BGIv1.0 annot-version=v1.0 MASSRTDSSVSLLGAVFLAVNLLIFFSPGAAATGTCPYDPSKLSVCATLLDSLIHVYAGTQPPAEPCCSVVCGVSADIDAAICACAALKANVLGVNLDLN VSLQLLLQKCGKQVPSGYVCV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10010765 [exp]	0	1
AT1G60500		DRP4C	Dynamin related protein 4C (.1...		Lus10025903 [exp]	4.1	0.9299
AT4G24700			unknown protein		Lus10017951 [exp]	4.2	0.8982
AT1G17020		ATSRG1, SRG1	senescence-related gene 1 (.1)		Lus10011986 [exp]	4.5	0.9238
AT4G36810		GGPS1	geranylgeranyl pyrophosphate s...		Lus10033581 [exp]	6.9	0.9048
AT1G70850		MLP34	MLP-like protein 34 (.1.2.3)		Lus10002644 [exp]	7.1	0.8987
AT1G20870			HSP20-like chaperones superfam...		Lus10007642 [exp]	8.5	0.9070
AT3G50470		MLA10, HR3	INTRACELLULAR MILDEW A 10, hom...		Lus10009328 [exp]	13.0	0.8945
AT1G68630			PLAC8 family protein (.1)		Lus10009036 [exp]	16.7	0.8692
					Lus10041745 [exp]	17.0	0.8938
AT4G13990			Exostosin family protein (.1)		Lus10005492 [exp]	17.3	0.8872

Compare expression of checked genes

Lus10010765 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.