Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000801 [exp] 191 / 8e-62 ND / Lus10005265 [exp] 173 / 4e-58 ND / Lus10015702 [exp] 176 / 6e-58 ND 38 / 0.004 Lus10032804 [exp] 176 / 1e-57 ND / Lus10020608 [exp] 167 / 2e-55 ND / Lus10003364 [exp] 167 / 2e-55 ND / Lus10005203 [exp] 166 / 1e-54 ND / Lus10036565 [exp] 162 / 2e-53 ND / Lus10000976 [exp] 162 / 3e-53 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010778 pacid=23147708 polypeptide=Lus10010778 locus=Lus10010778.g ID=Lus10010778.BGIv1.0 annot-version=v1.0 ATGTTCGAGAGGGCGTCGGCTGGTGGGGGTGTTGGTCCAGGGTACATGGACTGGTTCCTCGAGCATAGTCACCCACACATCGTGGCGCCGGCTAACCCCG GTGTGGGAGTCCCGGCTGAGCTGATTACACAGCGAGTGTTCAATGGTATGGCCTCCTACTTCGATGGTACGCTTGGGCGGCAGCACGCCGACTCTCTTCA GGAGTACTACGACCACATGGAGGGGCTTTGGATGCAGTTTGAGGATCTCTATACGGGGTATCGGAGCCAGAGAGAGAGTTGA
AA sequence Show only first row Show all	>Lus10010778 pacid=23147708 polypeptide=Lus10010778 locus=Lus10010778.g ID=Lus10010778.BGIv1.0 annot-version=v1.0 MFERASAGGGVGPGYMDWFLEHSHPHIVAPANPGVGVPAELITQRVFNGMASYFDGTLGRQHADSLQEYYDHMEGLWMQFEDLYTGYRSQRES

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10010778 [exp]	0	1
AT1G48120			hydrolases;protein serine/thre...		Lus10007708 [exp]	1.7	1.0000
AT3G25050		XTH3	xyloglucan endotransglucosylas...		Lus10011845 [exp]	2.8	1.0000
					Lus10008049 [exp]	3.2	1.0000
AT1G26420			FAD-binding Berberine family p...		Lus10023368 [exp]	3.9	1.0000
AT3G16180			Major facilitator superfamily ...		Lus10034936 [exp]	4.7	1.0000
AT1G48120			hydrolases;protein serine/thre...		Lus10008569 [exp]	5.2	1.0000
					Lus10040221 [exp]	5.3	1.0000
AT1G26480		GF14IOTA, GRF12	general regulatory factor 12 (...		Lus10026660 [exp]	5.9	1.0000
AT3G50440		ATMES10	ARABIDOPSIS THALIANA METHYL ES...		Lus10038486 [exp]	6.2	1.0000
					Lus10034512 [exp]	6.7	1.0000

Compare expression of checked genes

Lus10010778 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.