Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010783 pacid=23147710 polypeptide=Lus10010783 locus=Lus10010783.g ID=Lus10010783.BGIv1.0 annot-version=v1.0 ATGGTCCTCCCTCCCCCAAATTCGATTACGAGGAAACTGGTTTCACCGATGCTACCGACGAATCTATCGGCGACTGTGATGGCGAGGAATCCATCGGTTA CGGCGATTACAACGAAACTAGTTCTACTGATGAAGACGACTAATCCATCGACGACTTTGACGGCCACATCGATGACGGAGGAATCTCAGTGGAGGAGACG TTGCGGTGGGGAGAGAGGATCAAATCCGGAAGCGAGAAATAGCAATTTCGTCGTGCAGCGGTGGTTTTGA
AA sequence Show only first row Show all	>Lus10010783 pacid=23147710 polypeptide=Lus10010783 locus=Lus10010783.g ID=Lus10010783.BGIv1.0 annot-version=v1.0 MVLPPPNSITRKLVSPMLPTNLSATVMARNPSVTAITTKLVLLMKTTNPSTTLTATSMTEESQWRRRCGGERGSNPEARNSNFVVQRWF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10010783 [exp]	0	1
AT4G16780	HD	ATHB2, HAT4, AT...	ARABIDOPSIS THALIANA HOMEOBOX ...		Lus10007849 [exp]	7.3	0.8201
AT2G04570			GDSL-like Lipase/Acylhydrolase...		Lus10015162 [exp]	8.7	0.8640
AT4G29035			Plant self-incompatibility pro...		Lus10022825 [exp]	11.7	0.8514
					Lus10017869 [exp]	14.0	0.8485
AT5G10520		RBK1	ROP binding protein kinases 1 ...		Lus10002659 [exp]	17.2	0.8392
AT2G45650	MADS	AGL6	AGAMOUS-like 6 (.1)		Lus10015017 [exp]	18.7	0.8391
AT3G11780			MD-2-related lipid recognition...		Lus10013596 [exp]	19.0	0.7980
					Lus10040143 [exp]	19.6	0.7951
AT5G59050			unknown protein		Lus10001626 [exp]	20.4	0.8270
AT5G25610		ATRD22, RD22	RESPONSIVE TO DESSICATION 22, ...		Lus10022114 [exp]	20.4	0.8483

Compare expression of checked genes

Lus10010783 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.