Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G75130 211 / 4e-65 CYP721A1 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) AT2G26710 164 / 4e-47 CYP72B1, CYP734A1, BAS1 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) AT2G46950 154 / 4e-43 CYP709B2 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1) AT2G46960 148 / 2e-41 CYP709B1 "cytochrome P450, family 709, subfamily B, polypeptide 1", cytochrome P450, family 709, subfamily B, polypeptide 1 (.1.2) AT4G27710 146 / 1e-40 CYP709B3 "cytochrome P450, family 709, subfamily B, polypeptide 3", cytochrome P450, family 709, subfamily B, polypeptide 3 (.1) AT3G14630 128 / 6e-34 CYP72A9 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) AT3G14680 127 / 2e-33 CYP72A14 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1) AT3G14650 123 / 3e-32 CYP72A11 "cytochrome P450, family 72, subfamily A, polypeptide 11", cytochrome P450, family 72, subfamily A, polypeptide 11 (.1) AT3G14610 123 / 3e-32 CYP72A7 "cytochrome P450, family 72, subfamily A, polypeptide 7", cytochrome P450, family 72, subfamily A, polypeptide 7 (.1) AT3G14690 123 / 4e-32 CYP72A15 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016310 [exp] 251 / 1e-80 AT1G75130 596 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Lus10010821 [exp] 241 / 2e-76 AT1G75130 522 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Lus10033044 [exp] 171 / 9e-50 AT2G26710 803 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10025756 [exp] 145 / 6e-40 AT2G46950 578 / 0.0 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1) Lus10025755 [exp] 146 / 1e-39 AT1G80300 923 / 0.0 nucleotide transporter 1 (.1) Lus10006245 [exp] 138 / 8e-37 AT2G26710 345 / 4e-108 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10026085 [exp] 135 / 1e-36 AT2G46960 375 / 6e-125 "cytochrome P450, family 709, subfamily B, polypeptide 1", cytochrome P450, family 709, subfamily B, polypeptide 1 (.1.2) Lus10036820 [exp] 132 / 2e-35 AT2G26710 397 / 2e-133 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10019176 [exp] 130 / 9e-35 AT3G14620 342 / 8e-112 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G263800 [exp] 255 / 3e-82 AT1G75130 493 / 2e-171 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Potri.014G180500 [exp] 223 / 6e-70 AT1G75130 494 / 6e-172 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Potri.014G043000 [exp] 220 / 9e-69 AT1G75130 495 / 2e-172 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Potri.014G043100 [exp] 219 / 1e-68 AT1G75130 516 / 2e-180 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Potri.005G035200 [exp] 219 / 2e-68 AT1G75130 547 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Potri.002G134500 [exp] 211 / 6e-65 AT1G75130 540 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Potri.006G154500 [exp] 178 / 2e-52 AT2G26710 789 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.018G070900 [exp] 177 / 4e-52 AT2G26710 796 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.006G022200 [exp] 150 / 6e-42 AT2G46950 527 / 0.0 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1) Potri.011G117600 [exp] 133 / 7e-36 AT3G14620 479 / 7e-166 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10010799 pacid=23170753 polypeptide=Lus10010799 locus=Lus10010799.g ID=Lus10010799.BGIv1.0 annot-version=v1.0 ATGTCTCTAACAATTCTCATCCTTCACAAAGTCCTATGGCGTCCTTACATGACCCACCGGCCCTTTCTGAAGCAGGGGATTTCAGGCCCTGGCTACTGGC CGATCACCGGGAACTCGTTTGAGATGCGACAGAAGATGGCGGAAGCAAGATCCAAGAAGCTCCAGCCAACATCATCCGGCCATCATTGGGGAGTACTCAA GAGCCTAGTTCCAGCTTACTGCGATTGGTCTGCACTCTACGGGAAGACATTCCTGTACTGGTTAGGGCTGACTCCGAGGTTGAGTTTGTCCGACCCACTG TTGATAAAGAAAGTTCAGTTGAGTAAAGATGGGACCTTTGAGCGATTGGATTCGGACCCTTTGTCGAAGCAGCTCCTTGGAGATGGACTCTCTGAACTTA AAGGTCCGAAATGGGCTGTTCATAGAAGGATTGCTACACTTGCCTTGAACATGGAGCAAGTTAAGGTGACCAACAAGTTCCACCCTCCCAGTTGGATGCC GAAAATGGCGGATAGTACGTTGAAGATGTTTGAGAAATGGGAAACAGGACGAGAAGGGGAAGTTGATCAGATTGAGATGGACGTTCATAAGGAATTTCAT ACTCTTTCGGCGGATATAATCTCCAGAACCATTTTCGGAAGCAGCTTTGAAAAGGGCAAACTAATTTTCGAGTTGCAAGAGCGGCAGACTCATCTTCACT TTGCTTCTGTTTTCAGCGTCTATGTTCCAGGACTCAGGTTCTTGCCTACCAAGAACAACGTGGAAAGGTAG
AA sequence Show only first row Show all	>Lus10010799 pacid=23170753 polypeptide=Lus10010799 locus=Lus10010799.g ID=Lus10010799.BGIv1.0 annot-version=v1.0 MSLTILILHKVLWRPYMTHRPFLKQGISGPGYWPITGNSFEMRQKMAEARSKKLQPTSSGHHWGVLKSLVPAYCDWSALYGKTFLYWLGLTPRLSLSDPL LIKKVQLSKDGTFERLDSDPLSKQLLGDGLSELKGPKWAVHRRIATLALNMEQVKVTNKFHPPSWMPKMADSTLKMFEKWETGREGEVDQIEMDVHKEFH TLSADIISRTIFGSSFEKGKLIFELQERQTHLHFASVFSVYVPGLRFLPTKNNVER

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G75130		CYP721A1	"cytochrome P450, family 721, ...		Lus10010799 [exp]	0	1
AT1G54460			TPX2 (targeting protein for Xk...		Lus10022003 [exp]	1.4	0.9316
AT4G21690		ATGA3OX3	ARABIDOPSIS THALIANA GIBBERELL...		Lus10013134 [exp]	2.8	0.9346
AT3G05950			RmlC-like cupins superfamily p...		Lus10035280 [exp]	5.5	0.8619
AT3G54320	AP2_ERF	ATWRI1, ASML1, ...	WRINKLED 1, WRINKLED, ACTIVATO...		Lus10013268 [exp]	6.3	0.8619
AT3G29590		AT5MAT	HXXXD-type acyl-transferase fa...		Lus10003345 [exp]	7.1	0.8619
AT3G12500		PR-3, PR3, CHI-...	PATHOGENESIS-RELATED 3, basic ...		Lus10003585 [exp]	7.7	0.8619
AT3G04380		SDG31, SUVR4	SET DOMAIN PROTEIN 31, SET-dom...		Lus10005476 [exp]	8.4	0.8467
					Lus10014650 [exp]	9.4	0.8428
					Lus10027457 [exp]	9.9	0.8418
AT4G39010		ATGH9B18	glycosyl hydrolase 9B18 (.1)		Lus10042071 [exp]	10.0	0.5944

Compare expression of checked genes

Lus10010799 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.