Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G75130 211 / 1e-66 CYP721A1 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) AT2G26710 188 / 2e-57 CYP72B1, CYP734A1, BAS1 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) AT3G14690 187 / 2e-57 CYP72A15 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) AT3G14610 186 / 1e-56 CYP72A7 "cytochrome P450, family 72, subfamily A, polypeptide 7", cytochrome P450, family 72, subfamily A, polypeptide 7 (.1) AT3G14620 182 / 3e-55 CYP72A8 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) AT3G14630 182 / 4e-55 CYP72A9 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) AT3G14680 181 / 1e-54 CYP72A14 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1) AT3G14640 180 / 1e-54 CYP72A10 "cytochrome P450, family 72, subfamily A, polypeptide 10", cytochrome P450, family 72, subfamily A, polypeptide 10 (.1) AT3G14660 179 / 3e-54 CYP72A13 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) AT3G14650 173 / 8e-52 CYP72A11 "cytochrome P450, family 72, subfamily A, polypeptide 11", cytochrome P450, family 72, subfamily A, polypeptide 11 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016310 [exp] 284 / 1e-94 AT1G75130 596 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Lus10010802 [exp] 276 / 8e-94 AT1G75130 432 / 6e-150 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Lus10010821 [exp] 257 / 5e-84 AT1G75130 522 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Lus10017771 [exp] 196 / 1e-60 AT2G26710 705 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10033044 [exp] 194 / 1e-59 AT2G26710 803 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10026084 [exp] 192 / 9e-59 AT2G26710 375 / 6e-125 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10026085 [exp] 189 / 1e-57 AT2G46960 375 / 6e-125 "cytochrome P450, family 709, subfamily B, polypeptide 1", cytochrome P450, family 709, subfamily B, polypeptide 1 (.1.2) Lus10025756 [exp] 178 / 1e-53 AT2G46950 578 / 0.0 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1) Lus10002311 [exp] 175 / 2e-53 AT3G14630 317 / 8e-104 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G035200 [exp] 251 / 7e-82 AT1G75130 547 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Potri.002G134500 [exp] 231 / 6e-74 AT1G75130 540 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Potri.014G043100 [exp] 227 / 2e-72 AT1G75130 516 / 2e-180 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Potri.014G043000 [exp] 221 / 3e-70 AT1G75130 495 / 2e-172 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Potri.014G180500 [exp] 218 / 3e-69 AT1G75130 494 / 6e-172 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Potri.002G263800 [exp] 209 / 1e-65 AT1G75130 493 / 2e-171 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Potri.018G070900 [exp] 190 / 2e-58 AT2G26710 796 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.011G099200 [exp] 184 / 1e-57 AT3G14660 466 / 3e-163 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) Potri.011G101500 [exp] 186 / 6e-57 AT3G14690 609 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G098800 [exp] 186 / 9e-57 AT3G14690 640 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10010800 pacid=23170746 polypeptide=Lus10010800 locus=Lus10010800.g ID=Lus10010800.BGIv1.0 annot-version=v1.0 ATGACTTTTGCCCTTCTCTGCTTAGCCAATCATCAAGATTGGCAAGTTAAAGCCCGGGCGGAAGTGCTTCGTGTCTTTCGAAACATGGAATCTCCATCTG CTGAGGCTCTTGCCCAGCTTAAAATATTGAGTTTGATAATAAGCGAAACTTTGAGGATGTATCCTCCGGCTGCGATGCTACTGAGGGAAGCGACCAAGGA TGTTAAACTAGGAAGTCTACAAGTACCATCGGGAACACAAGTTTACGTGCCTTTGCTGGCCATTCATTACGACTCTGAAATATGGGGAGAAGATGCTCAC GAGTTCAATCCCTTGAGGTTCGACGAGTCTTCGAGAAAGCATTTAGCAGCGGATTTACCTTTCGGAAATGGTCCGAGAATCTGCGTGGGTCAGAACTTAG CCATGGTTGAAGCCAAGACCGTCCTGGCTACCATCATCAGAAACTACACCTTTGTCCTGTCGCCGACTTATGTTCATGCTCCCATGCTCTTGGTCAGTTT ACAGCCTCAGTACGGCGCTCAAATTGTCTTTACAAGGGTTTCTGCAACTTAG
AA sequence Show only first row Show all	>Lus10010800 pacid=23170746 polypeptide=Lus10010800 locus=Lus10010800.g ID=Lus10010800.BGIv1.0 annot-version=v1.0 MTFALLCLANHQDWQVKARAEVLRVFRNMESPSAEALAQLKILSLIISETLRMYPPAAMLLREATKDVKLGSLQVPSGTQVYVPLLAIHYDSEIWGEDAH EFNPLRFDESSRKHLAADLPFGNGPRICVGQNLAMVEAKTVLATIIRNYTFVLSPTYVHAPMLLVSLQPQYGAQIVFTRVSAT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G75130		CYP721A1	"cytochrome P450, family 721, ...		Lus10010800 [exp]	0	1
AT4G14060			Polyketide cyclase/dehydrase a...		Lus10008932 [exp]	5.7	0.8846
AT1G75130		CYP721A1	"cytochrome P450, family 721, ...		Lus10010801 [exp]	8.2	0.8166
AT1G54730			Major facilitator superfamily ...		Lus10002258 [exp]	11.2	0.8807
AT5G16970		AT-AER	alkenal reductase (.1)		Lus10035274 [exp]	13.4	0.8599
AT5G06730			Peroxidase superfamily protein...		Lus10008174 [exp]	19.2	0.8611
AT4G35160			O-methyltransferase family pro...		Lus10023987 [exp]	24.2	0.8516
AT4G04955		ATALN	allantoinase (.1)		Lus10018186 [exp]	31.2	0.8515
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Lus10006245 [exp]	37.9	0.8291
AT1G14185			Glucose-methanol-choline (GMC)...		Lus10032347 [exp]	41.1	0.8519
					Lus10018646 [exp]	44.0	0.7988

Compare expression of checked genes

Lus10010800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.