Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G75130 50 / 4e-08 CYP721A1 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) AT2G46960 42 / 5e-05 CYP709B1 "cytochrome P450, family 709, subfamily B, polypeptide 1", cytochrome P450, family 709, subfamily B, polypeptide 1 (.1.2) AT2G46950 41 / 0.0001 CYP709B2 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1) AT5G38450 39 / 0.0006 CYP735A1 "cytochrome P450, family 735, subfamily A, polypeptide 1", cytochrome P450, family 735, subfamily A, polypeptide 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016310 [exp] 97 / 4e-24 AT1G75130 596 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Lus10010821 [exp] 86 / 3e-20 AT1G75130 522 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Lus10010799 [exp] 45 / 3e-06 AT1G75130 211 / 2e-65 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Lus10025755 [exp] 45 / 7e-06 AT1G80300 923 / 0.0 nucleotide transporter 1 (.1) Lus10025756 [exp] 43 / 2e-05 AT2G46950 578 / 0.0 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1) Lus10035907 [exp] 43 / 2e-05 AT2G46950 498 / 7e-172 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1) Lus10033044 [exp] 40 / 0.0002 AT2G26710 803 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10005788 [exp] 39 / 0.0005 AT5G64790 565 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10013895 [exp] 39 / 0.0008 AT2G26710 102 / 8e-24 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G043000 [exp] 63 / 3e-12 AT1G75130 495 / 2e-172 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Potri.002G263800 [exp] 58 / 1e-10 AT1G75130 493 / 2e-171 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Potri.002G134500 [exp] 57 / 3e-10 AT1G75130 540 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Potri.006G154500 [exp] 39 / 0.0005 AT2G26710 789 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.018G070900 [exp] 38 / 0.0007 AT2G26710 796 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139200 [exp] 38 / 0.0008 AT2G26710 369 / 6e-123 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.014G180500 [exp] 0 / 1 AT1G75130 494 / 6e-172 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Potri.005G035200 [exp] 0 / 1 AT1G75130 547 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Potri.014G043100 [exp] 0 / 1 AT1G75130 516 / 2e-180 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010801 pacid=23170745 polypeptide=Lus10010801 locus=Lus10010801.g ID=Lus10010801.BGIv1.0 annot-version=v1.0 ATGAACCTGCATCTTCTGCTTCTACTGCTACTCGTGCTCTTAACTTGCTTCCTCCTCAAATTCCTACACGTCGTCATTTGGCTTCCCTTCTCCATCCAGC GCCACTTCAACAATCAGGGGATTACCGGCCCGGTCTACCGTCCGATTGACGGGAACTCTGCCGAGATCCGCCGTCTCTTCGCTAGAGTAGCTCAGTCGAA GTCATCGGCGTCATCTACCGGCGGCGGGGGCTTTCACCACCGGGATGTGGTGAGGAGGGCGTCTCCATTTTACCACGTATGGGAAGACTTTTCTTTACTG GTTTGGGCACAAACCCAGACTGGCTGTTTCGAGCCCCAACGTCATCAAGGATGTATTGCTGAACGCCGGCAGGTCGTTCGAGAAAGTCCGGTATAA
AA sequence Show only first row Show all	>Lus10010801 pacid=23170745 polypeptide=Lus10010801 locus=Lus10010801.g ID=Lus10010801.BGIv1.0 annot-version=v1.0 MNLHLLLLLLLVLLTCFLLKFLHVVIWLPFSIQRHFNNQGITGPVYRPIDGNSAEIRRLFARVAQSKSSASSTGGGGFHHRDVVRRASPFYHVWEDFSLL VWAQTQTGCFEPQRHQGCIAERRQVVRESPV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G75130		CYP721A1	"cytochrome P450, family 721, ...		Lus10010801 [exp]	0	1
AT2G32540		ATCSLB4, ATCSLB...	CELLULOSE SYNTHASE LIKE B4, ce...		Lus10030035 [exp]	2.4	0.8069
AT5G13550		SULTR4;1	sulfate transporter 4.1 (.1)		Lus10023440 [exp]	5.2	0.7401
AT1G27760		SAT32, ATSAT32	SALT-TOLERANCE 32, interferon-...		Lus10018689 [exp]	6.7	0.7213
AT1G75130		CYP721A1	"cytochrome P450, family 721, ...		Lus10010800 [exp]	8.2	0.8166
AT3G27030			unknown protein		Lus10041550 [exp]	13.1	0.7367
AT3G18670			Ankyrin repeat family protein ...		Lus10003282 [exp]	13.4	0.6891
AT4G27020			unknown protein		Lus10040054 [exp]	19.6	0.6243
AT3G18830		ATPMT5, AtPLT5	ARABIDOPSIS THALIANA POLYOL/MO...		Lus10042339 [exp]	23.6	0.6847
AT5G56180		ATARP8	actin-related protein 8 (.1.2)		Lus10025605 [exp]	25.1	0.6946
					Lus10008904 [exp]	26.2	0.6767

Compare expression of checked genes

Lus10010801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.