Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34950 102 / 1e-26 Major facilitator superfamily protein (.1) AT2G16660 100 / 5e-26 Major facilitator superfamily protein (.1) AT4G19450 72 / 5e-16 Major facilitator superfamily protein (.1) AT5G45275 72 / 6e-16 Major facilitator superfamily protein (.1) AT1G31470 62 / 1e-12 NFD4 NUCLEAR FUSION DEFECTIVE 4, Major facilitator superfamily protein (.1) AT1G80530 60 / 2e-11 Major facilitator superfamily protein (.1) AT3G01930 51 / 1e-08 Major facilitator superfamily protein (.1.2) AT5G14120 51 / 2e-08 Major facilitator superfamily protein (.1) AT5G50630 50 / 4e-08 Major facilitator superfamily protein (.1) AT5G50520 50 / 4e-08 Major facilitator superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025053 [exp] 129 / 4e-36 AT4G34950 793 / 0.0 Major facilitator superfamily protein (.1) Lus10034491 [exp] 128 / 6e-36 AT4G34950 788 / 0.0 Major facilitator superfamily protein (.1) Lus10033271 [exp] 71 / 2e-15 AT4G19450 516 / 0.0 Major facilitator superfamily protein (.1) Lus10034738 [exp] 71 / 2e-15 AT4G19450 691 / 0.0 Major facilitator superfamily protein (.1) Lus10001678 [exp] 71 / 3e-15 AT1G80530 649 / 0.0 Major facilitator superfamily protein (.1) Lus10026422 [exp] 66 / 1e-13 AT2G30300 379 / 5e-126 Major facilitator superfamily protein (.1) Lus10030111 [exp] 66 / 1e-13 AT1G80530 259 / 5e-83 Major facilitator superfamily protein (.1) Lus10017480 [exp] 64 / 4e-13 AT1G80530 702 / 0.0 Major facilitator superfamily protein (.1) Lus10028803 [exp] 64 / 6e-13 AT1G80530 707 / 0.0 Major facilitator superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G132700 [exp] 108 / 5e-29 AT4G34950 661 / 0.0 Major facilitator superfamily protein (.1) Potri.004G173400 [exp] 108 / 8e-29 AT4G34950 682 / 0.0 Major facilitator superfamily protein (.1) Potri.005G112400 [exp] 101 / 2e-26 AT4G34950 618 / 0.0 Major facilitator superfamily protein (.1) Potri.003G012300 [exp] 76 / 4e-17 AT1G80530 650 / 0.0 Major facilitator superfamily protein (.1) Potri.006G060900 [exp] 71 / 1e-15 AT1G80530 632 / 0.0 Major facilitator superfamily protein (.1) Potri.003G105600 [exp] 70 / 3e-15 AT4G19450 734 / 0.0 Major facilitator superfamily protein (.1) Potri.001G204700 [exp] 69 / 1e-14 AT1G80530 625 / 0.0 Major facilitator superfamily protein (.1) Potri.001G128200 [exp] 67 / 2e-14 AT4G19450 774 / 0.0 Major facilitator superfamily protein (.1) Potri.013G154000 [exp] 61 / 3e-12 AT2G30300 380 / 4e-127 Major facilitator superfamily protein (.1) Potri.019G126700 [exp] 58 / 5e-11 AT2G30300 427 / 4e-145 Major facilitator superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0015 [flax] [poplar] MFS PF06813 [flax] [poplar] Nodulin-like Nodulin-like
Representative CDS sequence Show only first row Show all	>Lus10010805 pacid=23170754 polypeptide=Lus10010805 locus=Lus10010805.g ID=Lus10010805.BGIv1.0 annot-version=v1.0 ATGGGCATAAACTTATTGATTGTTAACAGTTTAGTCATTCGCTTCAAATGGCTCGGCCTAGTCACCACCATCTGGGTCCAAGCAATCTCCGGCAACAACT ACACCTTCGCTAAATACTCTCACTCCCTCAAATCTCTAATGAACCTCAACCAGCTCCAGCTCAACAACCTCTCCGTCGCCAAGGACGTCGCCAAGGCCTT CGGTCTCCTCGCCGGACTCACCTCTGACCGCTTCCCTACCTGGCTCCTCCTCCTCATCGGCTCAATCGAAAGCCTCATCAGCTACGGCGTCCAGTGGCTC GTCGTCTGCCAGAGAATCTCCCCAATGCGATAA
AA sequence Show only first row Show all	>Lus10010805 pacid=23170754 polypeptide=Lus10010805 locus=Lus10010805.g ID=Lus10010805.BGIv1.0 annot-version=v1.0 MGINLLIVNSLVIRFKWLGLVTTIWVQAISGNNYTFAKYSHSLKSLMNLNQLQLNNLSVAKDVAKAFGLLAGLTSDRFPTWLLLLIGSIESLISYGVQWL VVCQRISPMR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34950			Major facilitator superfamily ...		Lus10010805 [exp]	0	1
					Lus10030316 [exp]	1.4	0.8318
AT2G32460	MYB	ATMYB101, AtM1	ARABIDOPSIS THALIANA MYB 1, my...		Lus10040063 [exp]	4.6	0.8303
AT1G05170			Galactosyltransferase family p...		Lus10001148 [exp]	4.7	0.8311
AT5G24090		ATCHIA	chitinase A (.1)		Lus10023534 [exp]	7.7	0.7857
AT2G37550		ASP1, AGD7	yeast pde1 suppressor 1, ARF-G...		Lus10036211 [exp]	10.6	0.7323
AT1G28480		roxy19, GRX480	Thioredoxin superfamily protei...		Lus10033649 [exp]	14.3	0.7248
AT3G60460	MYB	DUO1	DUO POLLEN 1, myb-like HTH tra...		Lus10009780 [exp]	15.1	0.8274
AT3G20530			Protein kinase superfamily pro...		Lus10019621 [exp]	17.9	0.7539
AT4G32030			unknown protein		Lus10001935 [exp]	18.6	0.8046
AT1G03910			unknown protein		Lus10030000 [exp]	20.8	0.7520

Compare expression of checked genes

Lus10010805 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.