Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06515 66 / 2e-15 Protein of unknown function (DUF3317) (.1), Protein of unknown function (DUF3317) (.2) AT2G30942 65 / 2e-15 Protein of unknown function (DUF3317) (.1) AT3G02330 64 / 3e-13 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G15510 62 / 4e-12 VAC1, ATECB2 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G49170 55 / 8e-10 EMB2261 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G41080 54 / 1e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G23330 54 / 2e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G33680 53 / 3e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G27110 52 / 9e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G13270 52 / 1e-08 RARE1 REQUIRED FOR ACCD RNA EDITING 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032091 [exp] 86 / 2e-20 AT3G02330 925 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10014594 [exp] 83 / 1e-19 AT3G02330 901 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10007167 [exp] 61 / 1e-13 AT2G30942 96 / 2e-28 Protein of unknown function (DUF3317) (.1) Lus10013991 [exp] 61 / 8e-12 AT3G57430 632 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10015414 [exp] 61 / 8e-12 AT3G57430 629 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10042161 [exp] 55 / 8e-10 AT3G49170 484 / 1e-163 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10034715 [exp] 54 / 3e-09 AT5G04780 676 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10021649 [exp] 53 / 3e-09 AT5G04780 342 / 4e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10031504 [exp] 53 / 4e-09 AT3G05340 754 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G111300 [exp] 74 / 2e-16 AT3G02330 1077 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G263100 [exp] 64 / 7e-15 AT2G30942 100 / 5e-30 Protein of unknown function (DUF3317) (.1) Potri.001G000400 [exp] 60 / 2e-13 AT2G30942 98 / 2e-29 Protein of unknown function (DUF3317) (.1) Potri.002G263300 [exp] 60 / 2e-13 AT2G30942 98 / 3e-29 Protein of unknown function (DUF3317) (.1) Potri.012G018800 [exp] 58 / 6e-11 AT2G13600 463 / 3e-152 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.015G018700 [exp] 57 / 1e-10 AT3G49170 1040 / 0.0 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G075800 [exp] 55 / 6e-10 AT3G57430 1189 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G100600 [exp] 55 / 1e-09 AT1G16480 397 / 1e-124 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.001G066100 [exp] 54 / 2e-09 AT5G13270 977 / 0.0 REQUIRED FOR ACCD RNA EDITING 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G006800 [exp] 52 / 7e-09 AT2G33680 780 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11779 [flax] [poplar] SPT_ssu-like Small subunit of serine palmitoyltransferase-like
Representative CDS sequence Show only first row Show all	>Lus10010818 pacid=23170735 polypeptide=Lus10010818 locus=Lus10010818.g ID=Lus10010818.BGIv1.0 annot-version=v1.0 ATGAACTGGATTCAGCGGAAGATCTATCTCTATAATGTCACTTTCGGGCTTTACATGTTGGATTGGTGGGAGCGTTACCTCTTCAATCCTGAACTGGAGC ATTATTCATGCATCGTCGATCTGTTAGGGAGACCGGGGCAGACAGGTGATGCTTTGAAGATTATTGAAGAATGCAATTTGAAGCTGATGCTGAGGAGAAT GAAGGAGAATAGGCTGAAGAAGGAACTGGGTTGCAGCTGGATTGAGATTAAGGATGAAGTGCATCCATTTCTTAGTGGAGAGAAGTCGCAACCTAGAGGG GAAGAGATATATGAGAACATCGGTATGCCGGTTAATTAG
AA sequence Show only first row Show all	>Lus10010818 pacid=23170735 polypeptide=Lus10010818 locus=Lus10010818.g ID=Lus10010818.BGIv1.0 annot-version=v1.0 MNWIQRKIYLYNVTFGLYMLDWWERYLFNPELEHYSCIVDLLGRPGQTGDALKIIEECNLKLMLRRMKENRLKKELGCSWIEIKDEVHPFLSGEKSQPRG EEIYENIGMPVN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G15510		VAC1, ATECB2	VANILLA CREAM 1, ARABIDOPSIS E...		Lus10010818 [exp]	0	1
					Lus10003489 [exp]	7.2	0.6814
AT5G48440			FAD-dependent oxidoreductase f...		Lus10025858 [exp]	38.6	0.6456
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10025522 [exp]	43.4	0.6427
AT1G17400			unknown protein		Lus10027660 [exp]	50.2	0.6248
					Lus10007590 [exp]	62.8	0.6521
AT4G40080			ENTH/ANTH/VHS superfamily prot...		Lus10002642 [exp]	108.2	0.6534
AT1G54730			Major facilitator superfamily ...		Lus10029962 [exp]	134.9	0.6242
AT1G13810			Restriction endonuclease, type...		Lus10010434 [exp]	144.0	0.6418

Compare expression of checked genes

Lus10010818 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.