Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G24530 45 / 9e-07 Transducin/WD40 repeat-like superfamily protein (.1) AT5G50120 44 / 2e-06 Transducin/WD40 repeat-like superfamily protein (.1) AT5G51980 44 / 4e-06 C3HZnF Transducin/WD40 repeat-like superfamily protein (.1.2) AT4G25440 43 / 6e-06 C3HZnF ZFWD1 zinc finger WD40 repeat protein 1 (.1) AT1G49450 40 / 5e-05 Transducin/WD40 repeat-like superfamily protein (.1) AT2G26490 39 / 0.0002 Transducin/WD40 repeat-like superfamily protein (.1) AT5G49200 38 / 0.0003 C3HZnF WD-40 repeat family protein / zfwd4 protein (ZFWD4) (.1) AT3G18950 37 / 0.0008 Transducin/WD40 repeat-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032062 [exp] 105 / 2e-28 AT4G25440 212 / 3e-65 zinc finger WD40 repeat protein 1 (.1) Lus10014595 [exp] 102 / 6e-27 AT5G14250 445 / 3e-150 FUSCA 11, COP9 SIGNALOSOME SUBUNIT 3, CONSTITUTIVE PHOTOMORPHOGENIC 13, Proteasome component (PCI) domain protein (.1), Proteasome component (PCI) domain protein (.2) Lus10032066 [exp] 100 / 1e-26 AT4G25440 343 / 5e-115 zinc finger WD40 repeat protein 1 (.1) Lus10014598 [exp] 90 / 3e-23 AT4G25440 134 / 2e-36 zinc finger WD40 repeat protein 1 (.1) Lus10021656 [exp] 82 / 8e-20 AT4G25440 329 / 9e-109 zinc finger WD40 repeat protein 1 (.1) Lus10014612 [exp] 81 / 1e-19 AT5G40880 131 / 3e-35 WD-40 repeat family protein / zfwd3 protein (ZFWD3) (.1) Lus10021640 [exp] 76 / 2e-18 AT4G25440 185 / 7e-57 zinc finger WD40 repeat protein 1 (.1) Lus10001652 [exp] 76 / 2e-18 AT5G51980 192 / 2e-59 Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10021648 [exp] 76 / 3e-17 AT4G25440 321 / 1e-105 zinc finger WD40 repeat protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G050900 [exp] 54 / 1e-09 AT1G24530 483 / 5e-170 Transducin/WD40 repeat-like superfamily protein (.1) Potri.014G077800 [exp] 49 / 5e-08 AT5G51980 391 / 5e-132 Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.015G137200 [exp] 45 / 9e-07 AT4G25440 587 / 0.0 zinc finger WD40 repeat protein 1 (.1) Potri.009G109500 [exp] 42 / 9e-06 AT3G18950 555 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.012G134800 [exp] 42 / 1e-05 AT4G25440 600 / 0.0 zinc finger WD40 repeat protein 1 (.1) Potri.003G051100 [exp] 40 / 5e-05 AT2G26490 223 / 2e-67 Transducin/WD40 repeat-like superfamily protein (.1) Potri.004G148400 [exp] 40 / 8e-05 AT3G18950 539 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.012G076000 [exp] 39 / 0.0001 AT5G50120 417 / 5e-145 Transducin/WD40 repeat-like superfamily protein (.1) Potri.015G070900 [exp] 39 / 0.0001 AT5G50120 398 / 2e-137 Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00400 [flax] [poplar] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Lus10010819 pacid=23170765 polypeptide=Lus10010819 locus=Lus10010819.g ID=Lus10010819.BGIv1.0 annot-version=v1.0 ATGGATGGAACGATCAAAGTCTGGGATGGCAGCACTTTCCAGTGCCTAGAGACCTTCAAGGGGCATGACGAAGCAGTGACGTCTTTACTCTGCTTCTCCA GCAGCTACTTGCTATCCTGCTCCCTGGATTGCGAGATCAAAGTATGGGGCCGCAGCATTAATAATGGAGAAGGGAGGCTTGAATTGATGTATACCCATCA AGAAGCAGACGGTGCTCTGGCCTTGAGTGGACTGTGGAGTCGATCTGAACGGGAAGTCGATGTTGTTATGCTCCTGGAATAA
AA sequence Show only first row Show all	>Lus10010819 pacid=23170765 polypeptide=Lus10010819 locus=Lus10010819.g ID=Lus10010819.BGIv1.0 annot-version=v1.0 MDGTIKVWDGSTFQCLETFKGHDEAVTSLLCFSSSYLLSCSLDCEIKVWGRSINNGEGRLELMYTHQEADGALALSGLWSRSEREVDVVMLLE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G51980	C3HZnF		Transducin/WD40 repeat-like su...		Lus10010819 [exp]	0	1
AT2G28180		CHX08, ATCHX8	CATION/H+ EXCHANGER 8, Cation...		Lus10021415 [exp]	8.9	0.8709
AT3G19184	B3		AP2/B3-like transcriptional fa...		Lus10019872 [exp]	14.9	0.8578
AT1G02335		GL22	germin-like protein subfamily ...		Lus10020632 [exp]	20.4	0.8383
AT2G13570	CCAAT	NF-YB7	"nuclear factor Y, subunit B7"...		Lus10033477 [exp]	21.9	0.8298
					Lus10011453 [exp]	23.0	0.8265
					Lus10038463 [exp]	27.3	0.8283
AT3G52080		CHX28	cation/hydrogen exchanger 28 (...		Lus10019716 [exp]	29.7	0.8242
					Lus10009439 [exp]	32.5	0.8244
					Lus10018225 [exp]	32.5	0.8254
AT3G63390			unknown protein		Lus10018745 [exp]	32.8	0.6599

Compare expression of checked genes

Lus10010819 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.