Lus10010822 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G15220 189 / 1e-62 Ribosomal protein L27 family protein (.1)
AT2G16930 187 / 8e-62 Ribosomal protein L27 family protein (.1.2.3)
AT5G40950 90 / 5e-23 RPL27 ribosomal protein large subunit 27 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007170 291 / 2e-103 AT5G15220 190 / 3e-63 Ribosomal protein L27 family protein (.1)
Lus10041553 98 / 4e-26 AT5G40950 241 / 2e-81 ribosomal protein large subunit 27 (.1)
Lus10012538 94 / 1e-24 AT5G40950 243 / 2e-82 ribosomal protein large subunit 27 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G009500 228 / 4e-78 AT5G15220 201 / 2e-67 Ribosomal protein L27 family protein (.1)
Potri.001G329500 97 / 6e-26 AT5G40950 253 / 2e-86 ribosomal protein large subunit 27 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01016 Ribosomal_L27 Ribosomal L27 protein
Representative CDS sequence
>Lus10010822 pacid=23170736 polypeptide=Lus10010822 locus=Lus10010822.g ID=Lus10010822.BGIv1.0 annot-version=v1.0
ATGTTCAATTTCACCTCAAGGATCTGTAGAGGCTTCAGTGTGAAGGATTTGGTCAGTAGCGCACCAGTCTACGAAACCTTCACCGATGTGTCCACCGGCG
GCAGCGGCCTTAATGTGATGTTCCGGAGATGGGCTACGAAGAAAACCGCAGGGTCGACGAAGAACGGAAGAGATTCCAAGCCCAAGTATCTTGGAGTGAA
AAAATTCGGCGGGGAGAGAGTAATTCCTGGGAATATCATAGTGAGGCAGAGAGGGACTCGGTTTCATCCTGGGAACTATGTGGGGATTGGTAGAGATCAT
ACTCTGTTTGCGCTCAAGGAAGGAAATGTCAAGTTCGAGACGCAGAAACTAACCGGCAGGAAATGGGTTCATGTTACCCCCAAGGAAGGCTATGATCTCC
ACCCTGTATATCAAGCAGATGGAATCTCTGCTTCTGCTTAA
AA sequence
>Lus10010822 pacid=23170736 polypeptide=Lus10010822 locus=Lus10010822.g ID=Lus10010822.BGIv1.0 annot-version=v1.0
MFNFTSRICRGFSVKDLVSSAPVYETFTDVSTGGSGLNVMFRRWATKKTAGSTKNGRDSKPKYLGVKKFGGERVIPGNIIVRQRGTRFHPGNYVGIGRDH
TLFALKEGNVKFETQKLTGRKWVHVTPKEGYDLHPVYQADGISASA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G15220 Ribosomal protein L27 family p... Lus10010822 0 1
AT1G16000 unknown protein Lus10023116 1.4 0.7687
AT3G59040 Tetratricopeptide repeat (TPR)... Lus10005058 4.6 0.6890
AT4G26210 Mitochondrial ATP synthase sub... Lus10040553 5.3 0.7063
AT2G36930 C2H2ZnF zinc finger (C2H2 type) family... Lus10014426 7.5 0.7430
AT5G42520 BBR_BPC BPC6, BBR/BPC6,... ARABIDOPSIS THALIANA BASIC PEN... Lus10012389 11.0 0.6748
AT5G46160 Ribosomal protein L14p/L23e fa... Lus10023296 11.0 0.7405
AT1G26750 unknown protein Lus10016383 28.7 0.6971
AT5G23040 CDF1 CELL GROWTH DEFECT FACTOR 1, P... Lus10038965 31.5 0.6581
AT2G38280 ATAMPD, FAC1 EMBRYONIC FACTOR1, ADENOSINE 5... Lus10005043 32.4 0.6711
AT4G31460 Ribosomal L28 family (.1) Lus10003683 32.7 0.6500

Lus10010822 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.