Lus10010828 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10010828 pacid=23170776 polypeptide=Lus10010828 locus=Lus10010828.g ID=Lus10010828.BGIv1.0 annot-version=v1.0
ATGTCTTTCTTATACCTCTCAACTTCTAAACCATATTCTCAATCTCCCTCTATCTGCCGTTTTTGCCTCTCGTTTTCATCATCTTCCTTCTGGCCGTTTA
GGATTCTCCACTTCACCGCTGTTATCTGCAGCGGTGAAACTATTGTGGTGGGTTGTGAGTATGCAATTTTCGGTGGAGAAAAGGTGATCTCCGACAACAG
GAATATCGATGAAGTCGTGACTCTCGTCATTGCACATTGTGGGAGGACATATTTTGTGGGCGGCGTCCCGGAATACAGGGGAGGTTCTACATGCACGCTC
CATCTGCTGAAGGAAGATATCTCACTTTTCTGA
AA sequence
>Lus10010828 pacid=23170776 polypeptide=Lus10010828 locus=Lus10010828.g ID=Lus10010828.BGIv1.0 annot-version=v1.0
MSFLYLSTSKPYSQSPSICRFCLSFSSSSFWPFRILHFTAVICSGETIVVGCEYAIFGGEKVISDNRNIDEVVTLVIAHCGRTYFVGGVPEYRGGSTCTL
HLLKEDISLF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10010828 0 1
AT5G26170 WRKY ATWRKY50, WRKY5... ARABIDOPSIS THALIANA WRKY DNA-... Lus10036624 6.3 0.9125
AT3G07960 PIP5K6 phosphatidylinositol-4-phospha... Lus10024151 7.7 0.8801
AT5G38420 Ribulose bisphosphate carboxyl... Lus10005093 8.7 0.8519
AT1G75250 MYB RSM3, ATRL6 RADIALIS-LIKE SANT/MYB 3, RAD-... Lus10033212 9.6 0.9111
AT2G24600 Ankyrin repeat family protein ... Lus10024845 10.6 0.8926
AT5G17540 HXXXD-type acyl-transferase fa... Lus10020330 10.8 0.9078
Lus10009699 11.0 0.9001
Lus10008289 15.3 0.8994
AT3G28540 P-loop containing nucleoside t... Lus10007270 16.4 0.8983
AT5G67360 ARA12 Subtilase family protein (.1) Lus10006303 20.7 0.8762

Lus10010828 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.