Plant FIBer expression Database

Lus10010842 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G02250 240 / 1e-75 ATMTRNASEII, RNR1, EMB2730 ribonucleotide reductase 1, EMBRYO DEFECTIVE 2730, ARABIDOPSIS THALIANA MITOCHONDRIAL RNASE II, Ribonuclease II/R family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024387
[exp]
268 / 5e-86 AT5G02250 1066 / 0.0 ribonucleotide reductase 1, EMBRYO DEFECTIVE 2730, ARABIDOPSIS THALIANA MITOCHONDRIAL RNASE II, Ribonuclease II/R family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G086200
[exp]
237 / 2e-74 AT5G02250 1085 / 0.0 ribonucleotide reductase 1, EMBRYO DEFECTIVE 2730, ARABIDOPSIS THALIANA MITOCHONDRIAL RNASE II, Ribonuclease II/R family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00773 RNB RNB domain
Representative CDS sequence
>Lus10010842 pacid=23163420 polypeptide=Lus10010842 locus=Lus10010842.g ID=Lus10010842.BGIv1.0 annot-version=v1.0
ATGTTCTTTTTGCCATTCTCACAGGGTGCAGTGGACACAACAAATATAGAAACTCGAATTAAAGTTGTTAACCCTGATGATCCAGAGCCGATAATCAACC
TCTATGTTGAAAATCAAGCCGACCGAGCAATGAGACTCTTCACTGAGATGATGATACTGTGTGGAGAAGTTATAGCAACCTCTGGATCCCAGACCAACAT
TCCTCTGCCATATCGAGGACAGCCTCAGTCAAATATTGACGTGTCTGCATTTTCACATCTTCCTGAAGGGCCTGTTAGGACTTCTGCCATTATTAAAATT
TTACGCGCTACAGAAATCGACTTTAGGAAGCCAATACGACATGGAATTTTGGGGCTTCCCGGTTATGTTCAGTTTACTTTGCCCATTCGTAGATACCTTG
ATCTGCTTGCGCATTATCAGGTGAATGAATGGCTACCTACCATCCATGTCAACAGAGGGAATGACATTAATGCCAAAATATAA
AA sequence
>Lus10010842 pacid=23163420 polypeptide=Lus10010842 locus=Lus10010842.g ID=Lus10010842.BGIv1.0 annot-version=v1.0
MFFLPFSQGAVDTTNIETRIKVVNPDDPEPIINLYVENQADRAMRLFTEMMILCGEVIATSGSQTNIPLPYRGQPQSNIDVSAFSHLPEGPVRTSAIIKI
LRATEIDFRKPIRHGILGLPGYVQFTLPIRRYLDLLAHYQVNEWLPTIHVNRGNDINAKI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G02250 ATMTRNASEII, RN... ribonucleotide reductase 1, EM... Lus10010842
[exp]
0 1
AT4G37460 SRFR1 SUPPRESSOR OF RPS4-RLD 1, Tetr... Lus10014863
[exp]
1.0 0.9211
AT3G48200 unknown protein Lus10008827
[exp]
1.4 0.8948
Lus10027391
[exp]
2.6 0.8556
AT2G25660 EMB2410 embryo defective 2410 (.1) Lus10022111
[exp]
3.0 0.8910
Lus10042563
[exp]
3.9 0.8822
AT1G26930 Galactose oxidase/kelch repeat... Lus10024239
[exp]
4.0 0.8884
AT3G22470 Pentatricopeptide repeat (PPR)... Lus10003426
[exp]
4.2 0.8496
AT1G01320 Tetratricopeptide repeat (TPR)... Lus10020453
[exp]
4.7 0.7970
AT5G66550 Maf-like protein (.1) Lus10040204
[exp]
4.9 0.8626
AT2G32760 unknown protein Lus10022575
[exp]
6.0 0.8149

Lus10010842 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.