Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G49710 101 / 5e-26 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G59200 100 / 8e-26 OTP80 ORGANELLE TRANSCRIPT PROCESSING 80, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G05750 97 / 1e-24 PDE247, CLB19 pigment defective 247, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G09410 97 / 2e-24 pentatricopeptide (PPR) repeat-containing protein (.1) AT2G29760 97 / 2e-24 OTP81 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G06540 97 / 2e-24 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G39350 96 / 7e-24 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G25060 95 / 8e-24 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G37380 94 / 3e-23 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G13770 93 / 5e-23 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024376 [exp] 238 / 5e-77 AT3G15130 370 / 1e-119 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10040680 [exp] 109 / 9e-29 AT2G29760 926 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10018223 [exp] 106 / 1e-27 AT2G29760 931 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10029344 [exp] 100 / 2e-25 AT5G06540 803 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10031423 [exp] 99 / 6e-25 AT5G66520 538 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10004253 [exp] 98 / 1e-24 AT3G49170 832 / 0.0 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10009913 [exp] 97 / 2e-24 AT3G09040 1114 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10014594 [exp] 97 / 2e-24 AT3G02330 901 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10019098 [exp] 97 / 3e-24 AT3G47840 697 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G076100 [exp] 172 / 7e-52 AT4G33170 383 / 1e-121 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.007G050200 [exp] 106 / 1e-27 AT4G37380 817 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G006400 [exp] 105 / 1e-27 AT1G56690 993 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G237000 [exp] 105 / 2e-27 AT5G66520 544 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.018G071800 [exp] 104 / 6e-27 AT1G08070 606 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G005400 [exp] 102 / 2e-26 AT1G56690 1018 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.016G065500 [exp] 101 / 4e-26 AT5G06540 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G111300 [exp] 100 / 2e-25 AT3G02330 1077 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G012600 [exp] 100 / 2e-25 AT2G29760 540 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G187800 [exp] 100 / 2e-25 AT3G09040 1201 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010853 pacid=23163414 polypeptide=Lus10010853 locus=Lus10010853.g ID=Lus10010853.BGIv1.0 annot-version=v1.0 ATGGTTGACACTTACGCAATTGTTCCTGAGACAGAGCATCCATCAAGTCTCATCGATATACTAGGACGCGCAGGGAGACTACACGACGCGGAAGAGTATG TTGACAGATTCCGGTTCGGAAACGATCCTATTGTGTTGGGGAGTCTCCCTGGATGTGTTTCACATGGAGATTTCGCCATGGGAGAGCGTATAGGGAAGAG GCTTCTGAAGCTTCAGCCGGAGACTACTTCACCTTATGTGTTGCTGTCGAATCTTTACGCTAGTGGTGAGATATGGAGAGGAGTTGCAGAGGCGAAGAGG ATGCTTAAGGGTAGCGGGCTGAAGAAAGAGCCTGGGCATAGCCTGATAGAATTGGATGGAGCTTTTGAAAAGTTCAGCAAGTGA
AA sequence Show only first row Show all	>Lus10010853 pacid=23163414 polypeptide=Lus10010853 locus=Lus10010853.g ID=Lus10010853.BGIv1.0 annot-version=v1.0 MVDTYAIVPETEHPSSLIDILGRAGRLHDAEEYVDRFRFGNDPIVLGSLPGCVSHGDFAMGERIGKRLLKLQPETTSPYVLLSNLYASGEIWRGVAEAKR MLKGSGLKKEPGHSLIELDGAFEKFSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59200		OTP80	ORGANELLE TRANSCRIPT PROCESSIN...		Lus10010853 [exp]	0	1
AT3G49740			Tetratricopeptide repeat (TPR)...		Lus10011562 [exp]	3.0	0.6616
AT4G34660			SH3 domain-containing protein ...		Lus10028785 [exp]	5.3	0.6422
AT1G11290		CRR22	CHLORORESPIRATORY REDUCTION22,...		Lus10028837 [exp]	7.1	0.6713
AT4G19191			Tetratricopeptide repeat (TPR)...		Lus10031028 [exp]	9.2	0.6735
AT1G01970			Tetratricopeptide repeat (TPR)...		Lus10015865 [exp]	9.7	0.5986
AT4G13750		EMB2597, NOV	NO VEIN, EMBRYO DEFECTIVE 2597...		Lus10037831 [exp]	19.6	0.6249
AT4G35380			SEC7-like guanine nucleotide e...		Lus10022975 [exp]	23.2	0.6382
AT5G13230			Tetratricopeptide repeat (TPR)...		Lus10025047 [exp]	25.8	0.5070
AT4G21065			Tetratricopeptide repeat (TPR)...		Lus10006628 [exp]	32.8	0.6275
AT5G40410			Tetratricopeptide repeat (TPR)...		Lus10005638 [exp]	39.3	0.5956

Compare expression of checked genes

Lus10010853 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.