Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G54420 51 / 2e-09 ATCHITIV, CHIV, ATEP3 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) AT2G43620 50 / 5e-09 Chitinase family protein (.1) AT4G01700 49 / 3e-08 Chitinase family protein (.1) AT2G43610 48 / 5e-08 Chitinase family protein (.1) AT3G12500 47 / 8e-08 PR-3, PR3, CHI-B, B-CHI, ATHCHIB PATHOGENESIS-RELATED 3, basic chitinase (.1) AT1G02360 46 / 1e-07 Chitinase family protein (.1) AT2G43590 43 / 2e-06 Chitinase family protein (.1) AT2G43580 41 / 1e-05 Chitinase family protein (.1) AT1G56680 38 / 0.0001 Chitinase family protein (.1) AT2G43570 37 / 0.0003 CHI "chitinase, putative", chitinase, putative (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035625 [exp] 68 / 2e-15 AT3G54420 266 / 7e-89 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) Lus10003226 [exp] 68 / 3e-15 AT3G54420 269 / 2e-89 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) Lus10003231 [exp] 67 / 3e-15 AT3G54420 241 / 2e-80 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) Lus10035618 [exp] 66 / 1e-14 AT2G43590 229 / 1e-75 Chitinase family protein (.1) Lus10024366 [exp] 64 / 3e-14 AT3G54420 226 / 2e-74 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) Lus10010862 [exp] 63 / 8e-14 AT2G43590 262 / 1e-88 Chitinase family protein (.1) Lus10010861 [exp] 63 / 8e-14 AT2G43590 263 / 6e-89 Chitinase family protein (.1) Lus10035620 [exp] 64 / 1e-13 AT2G43590 223 / 6e-71 Chitinase family protein (.1) Lus10024368 [exp] 63 / 1e-13 AT2G43590 264 / 2e-89 Chitinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G093900 [exp] 63 / 1e-13 AT3G54420 360 / 3e-126 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) Potri.019G094000 [exp] 62 / 3e-13 AT3G54420 340 / 2e-118 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) Potri.019G093800 [exp] 58 / 8e-12 AT3G54420 369 / 8e-130 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) Potri.013G125100 [exp] 58 / 9e-12 AT3G54420 336 / 1e-116 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) Potri.019G094100 [exp] 58 / 1e-11 AT3G54420 350 / 3e-122 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) Potri.009G141700 [exp] 52 / 2e-09 AT3G12500 405 / 3e-142 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.019G093700 [exp] 51 / 2e-09 AT3G54420 413 / 3e-147 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) Potri.009G142150 [exp] 51 / 3e-09 AT3G12500 365 / 8e-128 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.002G186500 [exp] 50 / 6e-09 AT1G02360 413 / 2e-147 Chitinase family protein (.1) Potri.004G182000 [exp] 50 / 6e-09 AT3G12500 460 / 5e-164 PATHOGENESIS-RELATED 3, basic chitinase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0037 [flax] [poplar] Lysozyme PF00182 [flax] [poplar] Glyco_hydro_19 Chitinase class I
Representative CDS sequence Show only first row Show all	>Lus10010860 pacid=23163463 polypeptide=Lus10010860 locus=Lus10010860.g ID=Lus10010860.BGIv1.0 annot-version=v1.0 ATGAAGAAGTACTACGGCAGAGGGCCGCTTCAGCTGACCTGGAACTACGATTACGAAGAGTACGGGCGGGCGAACCGATTTGACGGGTTGAACGACCCTG GCATTGTGAATCGTAGCCCGTGGTTGCCTGGAAGACGGCACTTTGGATTTGGATGTGGAGTGTTCGTCCGGTTTTGGATCATGGGTTCGGAGCCACGATC CGTCGGGTAA
AA sequence Show only first row Show all	>Lus10010860 pacid=23163463 polypeptide=Lus10010860 locus=Lus10010860.g ID=Lus10010860.BGIv1.0 annot-version=v1.0 MKKYYGRGPLQLTWNYDYEEYGRANRFDGLNDPGIVNRSPWLPGRRHFGFGCGVFVRFWIMGSEPRSVG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G01700			Chitinase family protein (.1)		Lus10010860 [exp]	0	1
AT5G10750			Protein of unknown function (D...		Lus10026907 [exp]	15.8	0.7496
AT5G40870		UKL1, ATUK/UPRT...	URIDINE KINASE-LIKE 1, uridine...		Lus10032051 [exp]	39.9	0.6796
AT1G05510			Protein of unknown function (D...		Lus10021483 [exp]	50.4	0.7160
AT3G07470			Protein of unknown function, D...		Lus10019216 [exp]	60.8	0.6897
AT4G10310		ATHKT1, HKT1	high-affinity K+ transporter 1...		Lus10026948 [exp]	66.5	0.6816
AT1G75800			Pathogenesis-related thaumatin...		Lus10033136 [exp]	82.3	0.6754
AT1G10550		XTH33, XET	xyloglucan:xyloglucosyl transf...		Lus10013000 [exp]	180.2	0.6382
AT5G05490		SYN1 BP5, SYN1 ...	SYNAPTIC 1, DETERMINATE, INFER...		Lus10022711 [exp]	240.7	0.6592
AT4G15440		CYP74B2, HPL1	hydroperoxide lyase 1 (.1)		Lus10030029 [exp]	294.5	0.6241

Compare expression of checked genes

Lus10010860 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.