Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02090 45 / 2e-07 unknown protein AT2G37750 42 / 2e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024357 [exp] 148 / 5e-48 AT5G02090 45 / 2e-07 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G090100 [exp] 76 / 1e-19 AT5G02090 59 / 1e-12 unknown protein Potri.016G101900 [exp] 75 / 4e-19 AT2G37750 57 / 2e-12 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010878 pacid=23163421 polypeptide=Lus10010878 locus=Lus10010878.g ID=Lus10010878.BGIv1.0 annot-version=v1.0 ATGGAAGGTTTGATTCCTTTCGTGTACAGAGCATTAACCCAACACAGCAGAAACGGAAGCAGGGCTGGATCAGGTGCTCTTAATTCCTGGTTCACCGATT CCCCTTCAATGTCCTACATCCGACTTCCCGGAGATTCCGGCAGGTTTCAGGCTTCTGATCATCTCCAGCTTCTGGCATCATCAGACTGCTCTACTTCCTC TGCTCCCTCCAATCTGAATTCATCCGCAGTCGTTTCCATCGGAGCTCAATCTCCGCTCTGCCGCTTCTCCCGCCGGGTGGCTGCCTGA
AA sequence Show only first row Show all	>Lus10010878 pacid=23163421 polypeptide=Lus10010878 locus=Lus10010878.g ID=Lus10010878.BGIv1.0 annot-version=v1.0 MEGLIPFVYRALTQHSRNGSRAGSGALNSWFTDSPSMSYIRLPGDSGRFQASDHLQLLASSDCSTSSAPSNLNSSAVVSIGAQSPLCRFSRRVAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G02090			unknown protein		Lus10010878 [exp]	0	1
AT1G14185			Glucose-methanol-choline (GMC)...		Lus10030457 [exp]	2.0	0.9777
AT1G23390			Kelch repeat-containing F-box ...		Lus10013033 [exp]	3.0	0.9647
AT5G03810			GDSL-like Lipase/Acylhydrolase...		Lus10008635 [exp]	3.7	0.9648
AT1G66230	MYB	ATMYB20	myb domain protein 20 (.1)		Lus10038913 [exp]	6.5	0.9635
AT1G10460		GLP7	germin-like protein 7 (.1)		Lus10010726 [exp]	11.1	0.9639
AT3G06260		GolS9, GATL4	galactinol synthase 9, galactu...		Lus10034012 [exp]	11.6	0.9607
					Lus10018095 [exp]	11.7	0.9335
AT1G21550			Calcium-binding EF-hand family...		Lus10000972 [exp]	11.9	0.9334
AT1G05675			UDP-Glycosyltransferase superf...		Lus10010468 [exp]	12.2	0.9439
AT1G43790		TED6	tracheary element differentiat...		Lus10029760 [exp]	13.0	0.9612

Compare expression of checked genes

Lus10010878 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.