Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37770 455 / 1e-162 ChlAKR, AKR4C9 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G37790 449 / 3e-160 AKR4C10 Aldo-keto reductase family 4 member C10, NAD(P)-linked oxidoreductase superfamily protein (.1) AT3G53880 409 / 4e-144 AKR4C11 Aldo-keto reductase family 4 member C11, NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G37760 404 / 3e-142 AKR4C8 Aldo-keto reductase family 4 member C8, NAD(P)-linked oxidoreductase superfamily protein AT5G62420 251 / 4e-82 NAD(P)-linked oxidoreductase superfamily protein (.1) AT5G01670 237 / 2e-76 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT1G59950 212 / 6e-67 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G59960 198 / 2e-61 NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G21250 193 / 1e-59 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G21260 189 / 4e-58 NAD(P)-linked oxidoreductase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024354 [exp] 527 / 0 AT2G37770 467 / 2e-163 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10010885 [exp] 453 / 9e-162 AT2G37770 502 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10024353 [exp] 414 / 4e-146 AT2G37770 491 / 1e-176 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10021491 [exp] 396 / 1e-139 AT2G37770 464 / 2e-166 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10012652 [exp] 372 / 5e-128 AT2G37770 441 / 4e-155 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10024350 [exp] 304 / 4e-100 AT3G53900 374 / 9e-128 PYRIMIDINE R, uracil phosphoribosyltransferase (.1.2) Lus10027216 [exp] 248 / 8e-81 AT5G62420 429 / 2e-152 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10031162 [exp] 243 / 1e-78 AT5G62420 431 / 1e-152 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10031739 [exp] 234 / 2e-75 AT5G62420 425 / 2e-150 NAD(P)-linked oxidoreductase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G102032 [exp] 466 / 6e-167 AT2G37770 424 / 2e-150 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.017G070600 [exp] 433 / 6e-154 AT2G37770 438 / 6e-156 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102100 [exp] 433 / 7e-154 AT2G37770 400 / 5e-141 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.006G090600 [exp] 425 / 1e-150 AT2G37770 503 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102300 [exp] 376 / 3e-131 AT2G37770 398 / 5e-140 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.001G125400 [exp] 243 / 4e-79 AT5G62420 445 / 2e-158 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.005G097000 [exp] 235 / 1e-75 AT1G59960 405 / 2e-142 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.008G193100 [exp] 232 / 2e-74 AT1G59960 420 / 3e-148 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.008G144600 [exp] 223 / 9e-71 AT2G37770 251 / 1e-81 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.010G097800 [exp] 219 / 3e-69 AT2G37770 250 / 3e-81 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00248 [flax] [poplar] Aldo_ket_red Aldo/keto reductase family
Representative CDS sequence Show only first row Show all	>Lus10010884 pacid=23163450 polypeptide=Lus10010884 locus=Lus10010884.g ID=Lus10010884.BGIv1.0 annot-version=v1.0 ATGGCGCAGTCTATCCGCTTTTTCGAGCTGAACACAGGAGCCAAGATCCCCTCGGTCGGGCTCGGGACTTGGCAAGCTGCTCCTGGCGTCGTCGGCGATG CCGTCACCACTGCCATCAAGGTTGGATACAGACACATCGATTGTGCTCAGGTCTATGGTAACGAGAAAGAGCTTGGCTCTGCTCTTAAGAAGCTATTTGA TGGTGGAGTTGTTAAGCGTGAAGAGCTCTGGATTACTTCTAAACTTTGGTGTAAGGATCATGCTCCTGAAGATGTACCAGATGCATTGGATAGGACTTTG AGTGACTTGCAGCTTGACTATGTGGATCTTTATCTAGTCCACTGGCCTGTGAAGATGAAGAAAGGCTCGGTAGGTTTCAAGGCCGAGAACTTCGAAATCC CAGACATTCCCGCTACATGGAAGGCAATGGAGGCCTTGCATGATTCCGCCAAGGCCAAGGCAATTGGAGTCAGTAATTTCTCGTCGAAGAAGCTCGCGGA TCTGCTAGCTATAGCTCGTATCTCCCCTGCTGTTAACCAAGTTGAATCCCATCCTGTGTGGCAGCAGCCAAAGCTCCACGAGTTCTGCAACTCCAAGGGC GTTCATCTCTCCGGCTATTCTCCATTGGGGTCCCCAGGCACGGGAAGCATCAACACCGAGGTGCTCAAGCATCCGATTCTCACTTCGGTTGCAGAGGAAT TGGGTAAATCACCTGCCCAAGTCGCCCTGCGATGGGGGATACAAACCGGGCGCAGTGTTCTGCCAAAGAGCACAAACGAGTCGAGGATCAAGGAGAACTT TGATGTTCAGGACTGGTCTATCCCTGACAACTTGCTTACCGAGTTATCTGACATTGAGCAGGAGAGACTAATTAGAGGCGATTTTTTCGTTAGTCAGACT TACGGGTTGTACAAGAGTGTGGAACAACTTTGGGACGGTGAACTTTGA
AA sequence Show only first row Show all	>Lus10010884 pacid=23163450 polypeptide=Lus10010884 locus=Lus10010884.g ID=Lus10010884.BGIv1.0 annot-version=v1.0 MAQSIRFFELNTGAKIPSVGLGTWQAAPGVVGDAVTTAIKVGYRHIDCAQVYGNEKELGSALKKLFDGGVVKREELWITSKLWCKDHAPEDVPDALDRTL SDLQLDYVDLYLVHWPVKMKKGSVGFKAENFEIPDIPATWKAMEALHDSAKAKAIGVSNFSSKKLADLLAIARISPAVNQVESHPVWQQPKLHEFCNSKG VHLSGYSPLGSPGTGSINTEVLKHPILTSVAEELGKSPAQVALRWGIQTGRSVLPKSTNESRIKENFDVQDWSIPDNLLTELSDIEQERLIRGDFFVSQT YGLYKSVEQLWDGEL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G37770		ChlAKR, AKR4C9	Chloroplastic aldo-keto reduct...		Lus10010884 [exp]	0	1
AT5G47040		LON2	lon protease 2 (.1)		Lus10040131 [exp]	4.4	0.8894
AT5G47040		LON2	lon protease 2 (.1)		Lus10001084 [exp]	6.2	0.8892
AT4G16130		ATISA1, ARA1	arabinose kinase (.1)		Lus10020178 [exp]	8.5	0.8715
AT5G19120			Eukaryotic aspartyl protease f...		Lus10021939 [exp]	9.4	0.8611
AT5G21170		AKINBETA1	5'-AMP-activated protein kinas...		Lus10041287 [exp]	9.5	0.8433
AT2G22040			Transducin/WD40 repeat-like su...		Lus10026332 [exp]	10.8	0.7664
AT5G02020		SIS	Salt Induced Serine rich, unkn...		Lus10021101 [exp]	15.2	0.8404
AT5G02320	MYB	MYB3R-5, ATMYB3...	ARABIDOPSIS THALIANA MYB DOMAI...		Lus10008010 [exp]	17.7	0.8304
AT4G35780		STY17	serine/threonine/tyrosine kina...		Lus10012517 [exp]	18.5	0.8035
					Lus10036703 [exp]	19.2	0.8297

Compare expression of checked genes

Lus10010884 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.