Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37770 481 / 9e-173 ChlAKR, AKR4C9 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G37790 466 / 5e-167 AKR4C10 Aldo-keto reductase family 4 member C10, NAD(P)-linked oxidoreductase superfamily protein (.1) AT3G53880 460 / 2e-164 AKR4C11 Aldo-keto reductase family 4 member C11, NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G37760 431 / 8e-153 AKR4C8 Aldo-keto reductase family 4 member C8, NAD(P)-linked oxidoreductase superfamily protein AT5G01670 258 / 7e-85 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT5G62420 256 / 4e-84 NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G21250 225 / 3e-72 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G21260 223 / 2e-71 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G59960 219 / 1e-69 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G59950 211 / 2e-66 NAD(P)-linked oxidoreductase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024354 [exp] 509 / 3e-180 AT2G37770 467 / 2e-163 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10021491 [exp] 472 / 2e-169 AT2G37770 464 / 2e-166 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10010884 [exp] 463 / 2e-165 AT2G37770 484 / 5e-174 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10024353 [exp] 463 / 2e-165 AT2G37770 491 / 1e-176 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10012652 [exp] 417 / 4e-146 AT2G37770 441 / 4e-155 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10024350 [exp] 336 / 1e-112 AT3G53900 374 / 9e-128 PYRIMIDINE R, uracil phosphoribosyltransferase (.1.2) Lus10029208 [exp] 263 / 1e-86 AT1G59960 406 / 7e-143 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10027216 [exp] 262 / 3e-86 AT5G62420 429 / 2e-152 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10010720 [exp] 261 / 5e-86 AT1G59960 410 / 2e-144 NAD(P)-linked oxidoreductase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G102032 [exp] 484 / 5e-174 AT2G37770 424 / 2e-150 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.006G090600 [exp] 477 / 3e-171 AT2G37770 503 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102100 [exp] 443 / 1e-157 AT2G37770 400 / 5e-141 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.017G070600 [exp] 441 / 5e-157 AT2G37770 438 / 6e-156 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102300 [exp] 403 / 6e-142 AT2G37770 398 / 5e-140 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.008G193100 [exp] 264 / 4e-87 AT1G59960 420 / 3e-148 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.005G097000 [exp] 260 / 1e-85 AT1G59960 405 / 2e-142 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.001G125400 [exp] 257 / 2e-84 AT5G62420 445 / 2e-158 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.008G144600 [exp] 247 / 5e-80 AT2G37770 251 / 1e-81 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.010G097800 [exp] 243 / 2e-78 AT2G37770 250 / 3e-81 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00248 [flax] [poplar] Aldo_ket_red Aldo/keto reductase family
Representative CDS sequence Show only first row Show all	>Lus10010885 pacid=23163440 polypeptide=Lus10010885 locus=Lus10010885.g ID=Lus10010885.BGIv1.0 annot-version=v1.0 ATGGCGAACGACATTTCATTCTTCGAATTGAACACCGGAGCCAAGATGCCGTCGGTAGGGCTCGGCACTTGGCAGGCTGAGCCTGGCGTCGTCGGAGCTG CCGTCGAGGCTGCAATCAAGATTGGTTACCGGCACATCGATTGTGCTCGACTTTATAAGAACGAAAAGGAGATTGGTGAAGTCCTGAAGAAGCTCTTTCA AGAGGGTGTAGTGAAGCGTGAGGATTTGTTCATTACTTCAAAGCTCTGGTGCAATGCGCATCATCCAGAAGATGTGCCAGGAGCACTAGAGAAAACTTTA AGAGAGCTACAGCTTGATTATGTTGATCTCTATCTTATTCACTGGCCGGTTGCGATGAAGAGAGGCGCAGAGGACTTTCTATCAGAGAACCTTGCACAGC TAGACATCCCAAGCACATGGCGAGCAATGGAAGCGCTTTACGATTCAGGAAAGGCTCGTGCTATTGGTGTGAGTAACTTCTCCGTGAAGAAGCTGGGAGA TCTGTTGCAAGTGGCTCGGGTGACTCCTGCTGTGAATCAGGTGGAATGTCATCCAGTATGGCAGCAGCCCAAACTCCACACCTTCTGTCAGTCCAAGGGC ATCCACCTATCAGGATATTCTCCACTGGGATCTCCTGGAACCACATGGATCAAAGGTGATGTCCTCAAGAATCCAATCCTGACCACGGTTGCGGAAAAGA TGGGTAAAACTCCGGCACAGGTGGCCCTCCGTTGGGGACTGCAAATGGGTCACAGTGTGCTACCAAAGAGTACCAATGAAACAAGGATCAAGGAGAATAT ACAAGTCCACGGCTGGTCTATCCCTGCAGACTTGTTTGCGAAATTTAGTGAAATCGAACAGGAAAGGCTTGTGAAGGGAAGTGGATTCGTACACGAGACT TACGGTGGATACAGGAGCCTCGAGGAATTGTGGGATGGTGAACTCTGA
AA sequence Show only first row Show all	>Lus10010885 pacid=23163440 polypeptide=Lus10010885 locus=Lus10010885.g ID=Lus10010885.BGIv1.0 annot-version=v1.0 MANDISFFELNTGAKMPSVGLGTWQAEPGVVGAAVEAAIKIGYRHIDCARLYKNEKEIGEVLKKLFQEGVVKREDLFITSKLWCNAHHPEDVPGALEKTL RELQLDYVDLYLIHWPVAMKRGAEDFLSENLAQLDIPSTWRAMEALYDSGKARAIGVSNFSVKKLGDLLQVARVTPAVNQVECHPVWQQPKLHTFCQSKG IHLSGYSPLGSPGTTWIKGDVLKNPILTTVAEKMGKTPAQVALRWGLQMGHSVLPKSTNETRIKENIQVHGWSIPADLFAKFSEIEQERLVKGSGFVHET YGGYRSLEELWDGEL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G37770		ChlAKR, AKR4C9	Chloroplastic aldo-keto reduct...		Lus10010885 [exp]	0	1
AT2G47140		AtSDR5	short-chain dehydrogenase redu...		Lus10021257 [exp]	2.8	0.9798
AT3G48280		CYP71A25	"cytochrome P450, family 71, s...		Lus10043308 [exp]	3.2	0.9794
					Lus10041161 [exp]	3.2	0.9722
AT3G48280		CYP71A25	"cytochrome P450, family 71, s...		Lus10043313 [exp]	4.5	0.9740
					Lus10027376 [exp]	5.5	0.9765
AT1G18140		LAC1, ATLAC1	laccase 1 (.1)		Lus10040936 [exp]	12.4	0.9631
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Lus10004908 [exp]	13.1	0.9671
AT2G23770			protein kinase family protein ...		Lus10019661 [exp]	15.8	0.9653
AT3G26330		CYP71B37	"cytochrome P450, family 71, s...		Lus10010545 [exp]	15.9	0.9686
AT1G14185			Glucose-methanol-choline (GMC)...		Lus10032641 [exp]	16.5	0.9563

Compare expression of checked genes

Lus10010885 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.