Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G19680 79 / 1e-18 Leucine-rich repeat (LRR) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012715 [exp] 127 / 6e-37 AT5G19680 458 / 2e-163 Leucine-rich repeat (LRR) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G163900 [exp] 95 / 1e-24 AT5G19680 513 / 0.0 Leucine-rich repeat (LRR) family protein (.1) Potri.018G086200 [exp] 88 / 4e-22 AT5G19680 486 / 5e-174 Leucine-rich repeat (LRR) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [flax] [poplar] LRR PF00560 [flax] [poplar] LRR_1 Leucine Rich Repeat
Representative CDS sequence Show only first row Show all	>Lus10010892 pacid=23172436 polypeptide=Lus10010892 locus=Lus10010892.g ID=Lus10010892.BGIv1.0 annot-version=v1.0 ATGGACGGGCAACCGCCGGAGAATCCTCCGTCACTGGATGGAGCTCTCGAGGAGATGAATGACACCATGCTCGACCTCACCAGCTGCCAACTCCACGATC TCAGCTCCGTCGAGCTACCGCCCACGCTCACCGAGCTAGACCTCACTGCCAATCGCTTGTCCACCTTGGACCCTAGGATTTCCAATCTCTCGAATCTCAC CAAGCTCTCTCTCCGCCAGAACCTGATCGACGATGCCGCAATTGATCCCCTCTCTCGTTGGGAACTCCTCTCCGGCCTCGAGGCAAGCCCTAACTAA
AA sequence Show only first row Show all	>Lus10010892 pacid=23172436 polypeptide=Lus10010892 locus=Lus10010892.g ID=Lus10010892.BGIv1.0 annot-version=v1.0 MDGQPPENPPSLDGALEEMNDTMLDLTSCQLHDLSSVELPPTLTELDLTANRLSTLDPRISNLSNLTKLSLRQNLIDDAAIDPLSRWELLSGLEASPN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G19680			Leucine-rich repeat (LRR) fami...		Lus10010892 [exp]	0	1
AT4G32330			TPX2 (targeting protein for Xk...		Lus10002915 [exp]	4.0	0.8691
AT4G03390		SRF3	STRUBBELIG-receptor family 3 (...		Lus10018459 [exp]	5.7	0.8804
AT1G24510			TCP-1/cpn60 chaperonin family ...		Lus10011401 [exp]	6.3	0.8766
AT3G47850			unknown protein		Lus10042163 [exp]	7.7	0.8490
AT2G05920			Subtilase family protein (.1)		Lus10034900 [exp]	11.4	0.8543
AT3G13060		ECT5	evolutionarily conserved C-ter...		Lus10037028 [exp]	12.3	0.8523
AT2G18510		EMB2444	embryo defective 2444, RNA-bin...		Lus10024024 [exp]	14.0	0.8756
AT3G04610		FLK	flowering locus KH domain, RNA...		Lus10005530 [exp]	21.6	0.8541
AT2G29210			splicing factor PWI domain-con...		Lus10001561 [exp]	24.4	0.8519
AT2G39870			unknown protein		Lus10040247 [exp]	25.7	0.8447

Compare expression of checked genes

Lus10010892 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.