Lus10010902 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G18840 148 / 2e-41 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G08070 142 / 7e-39 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G42920 135 / 7e-37 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT5G06540 127 / 1e-33 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G29760 127 / 2e-33 OTP81 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G22410 126 / 4e-33 SLO1 SLOW GROWTH 1 (.1)
AT1G59720 125 / 5e-33 CRR28 CHLORORESPIRATORY REDUCTION28, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G66520 125 / 8e-33 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G26630 123 / 1e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G48910 124 / 2e-32 LPA66 LOW PSII ACCUMULATION 66, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030932 145 / 6e-40 AT3G29230 318 / 3e-100 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10040680 137 / 5e-37 AT2G29760 926 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10030053 135 / 4e-36 AT1G08070 884 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10039703 132 / 2e-35 AT4G18750 394 / 6e-127 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10033026 132 / 2e-35 AT1G08070 921 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10014298 132 / 3e-35 AT5G66520 748 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10017386 128 / 5e-35 AT5G08305 357 / 9e-120 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10002552 125 / 9e-35 AT2G22410 299 / 2e-97 SLOW GROWTH 1 (.1)
Lus10026006 128 / 1e-33 AT5G66520 746 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G011000 280 / 2e-89 AT1G08070 572 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.003G087100 160 / 2e-45 AT3G29230 368 / 1e-119 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G019500 146 / 3e-40 AT2G22410 791 / 0.0 SLOW GROWTH 1 (.1)
Potri.003G031600 146 / 4e-40 AT3G15930 784 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G202600 143 / 9e-40 AT2G42920 660 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.016G065500 142 / 8e-39 AT5G06540 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G108500 140 / 9e-39 AT4G18840 382 / 3e-127 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.007G073100 140 / 9e-39 AT5G08305 600 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G207500 140 / 2e-38 AT5G37570 602 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.006G231200 136 / 6e-37 AT5G66520 504 / 1e-172 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10010902 pacid=23172532 polypeptide=Lus10010902 locus=Lus10010902.g ID=Lus10010902.BGIv1.0 annot-version=v1.0
ATGAATCTGATCAACCTCATCAGTCTCTCTGCATCAGTCAACCCATCGACAAGGAATCCTACGTTAACACTCACAATCCTAGACGCCCTTCTGCACCAAT
GCCGGAGCTTGAATCATTTCAATCAAATACTATCTCAAACGATCACCACCGGTTTCCTCGTCGCCGATACTTTCGCTGCCGGTAAGCTTCTCAAGTTCTC
CACCAGCTCGCCCTTCATCTCCCTGACTCACTCCCACCGCATCTTCACTCACATCACGGATCCGAACGCGTTCGTTTACAACACCATAATGAGAGCTCAT
GTGATGAGAAACCATCCTGAGCAAGCTCTGATCTTTTACAAAATGATGCGTGATGATGATCACGTTGGCCCTGATACTTACACGTACCCGATTCTGCTTC
AGTCCTGCTCGCAGAGGTTAGCTGAGTTCAAAGGGAGATCGATTCACGGACAAGTTTTGAAAGTCGGGTTTGATTCGGATGTTTATGTGCAGAATACGTT
GATTAATCTGTATTCAGTCTGCGGGAAGTTGAGCGATGCCCGCCAGGTGTTTGACGAAAGTCCTATCCTGGACTTGGTATCGTGGAACTCGATGCTGGCC
GGGTATATCTCCGGAGAGAATGTGGATGAGGCGAAATCAATATTCAATACAATGCGTAAGAGGAATGTGATCGCTTCCAATTCGATGATTGTGTTGTTTG
GGAAGAGTTAA
AA sequence
>Lus10010902 pacid=23172532 polypeptide=Lus10010902 locus=Lus10010902.g ID=Lus10010902.BGIv1.0 annot-version=v1.0
MNLINLISLSASVNPSTRNPTLTLTILDALLHQCRSLNHFNQILSQTITTGFLVADTFAAGKLLKFSTSSPFISLTHSHRIFTHITDPNAFVYNTIMRAH
VMRNHPEQALIFYKMMRDDDHVGPDTYTYPILLQSCSQRLAEFKGRSIHGQVLKVGFDSDVYVQNTLINLYSVCGKLSDARQVFDESPILDLVSWNSMLA
GYISGENVDEAKSIFNTMRKRNVIASNSMIVLFGKS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G18840 Pentatricopeptide repeat (PPR-... Lus10010902 0 1
AT5G45610 SUV2 SENSITIVE TO UV 2, protein dim... Lus10012118 2.8 0.8031
AT4G14850 MEF11, LOI1 lovastatin insensitive 1, Pent... Lus10006123 4.0 0.7933
AT1G11290 CRR22 CHLORORESPIRATORY REDUCTION22,... Lus10016509 8.8 0.7851
AT3G56550 Pentatricopeptide repeat (PPR)... Lus10037387 18.8 0.7474
AT4G14050 Pentatricopeptide repeat (PPR)... Lus10040634 19.1 0.7639
AT5G23200 unknown protein Lus10010192 21.9 0.7545
AT5G46460 Pentatricopeptide repeat (PPR)... Lus10015256 22.4 0.7162
AT5G46100 Pentatricopeptide repeat (PPR)... Lus10013972 24.3 0.7797
AT2G02750 Pentatricopeptide repeat (PPR)... Lus10000073 27.2 0.7688
AT3G09040 Pentatricopeptide repeat (PPR)... Lus10010169 29.8 0.7488

Lus10010902 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.