Lus10010936 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G23730 370 / 1e-129 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT4G14130 362 / 9e-127 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT5G57560 361 / 2e-126 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT4G25810 348 / 3e-121 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT4G30270 347 / 5e-121 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT5G57550 345 / 6e-120 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT5G57530 325 / 4e-112 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT5G57540 324 / 7e-112 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
AT4G25820 318 / 1e-109 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1)
AT5G48070 317 / 5e-109 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031393 511 / 0 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10034098 510 / 0 AT3G23730 376 / 5e-132 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10003048 509 / 0 AT3G23730 380 / 7e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010939 509 / 0 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010938 508 / 0 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10031392 507 / 0 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10007349 436 / 5e-156 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020772 434 / 4e-155 AT3G23730 393 / 7e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020773 434 / 7e-155 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G201250 424 / 4e-151 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201200 421 / 4e-150 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060500 421 / 8e-150 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 403 / 8e-143 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G236200 385 / 7e-136 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.014G146100 385 / 7e-136 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.011G077320 379 / 2e-133 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.018G095100 357 / 7e-125 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095200 354 / 1e-123 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.013G005700 354 / 7e-123 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10010936 pacid=23172457 polypeptide=Lus10010936 locus=Lus10010936.g ID=Lus10010936.BGIv1.0 annot-version=v1.0
ATGGCGGCAACTCTGCCTATGGTGATGTTAGTGATGATGTTGGGTCATCTAATGGCAGTCTCAAACGCCAACTTCAACCAGCATTTTGATGTCACTTGGG
GGCATCACCATGCTCAGATCATGAACGGCGGCCAGCAATTGACCCTCTCGCTCGACAAGGATTCCGGTGCTGGTTTCAAGTCCAAGAATGAGTATCTCTT
TGGCCGTGTCGATATGCAGCTCAAACTCATCGCCGGCAACTCTGCTGGAAGTGTCACTACATTCTACCTATCGTCAGCAGAAGGACCGAATCACGACGAG
ATCGACTTCGAGTTTCTCGGTAACTCCAGTGGGAGTCCTTACACCGTACACACCAATGTGTTTAGCCAAGGAAAAGGCAACCGAGAACAGCAGTTCCATC
TCTGGTTCGACCCTACCGCAGCTTTCCACACCTACACCATCCTCTGGAATTCTCAAAGAATCATATTCTTGGTGGACAACATTCCGATCAGAGTGTTCAA
CAACCTGGAATCAATGGGAGTTCCATTCCCCAACAAGAAGCCAATGAGCATCCACTCGAGCTTATGGAACGCTGATGACTGGGCCACGCAGGGCGGCCGA
GTGAAGGCCGACTGGACCAAGGCTCCTTTCGTCGCATCTTACCGGAACTTCAAGGCCGAAGCCTGCGTCTGGTCACCATCCTCGTCCTCCTCGACTTGCT
CTCCCGGAGCATGGCAGACTCAGGGGATCGATGCCGCCGGCCGTAACAGAATCCGATGGGTACAGAGTAAATATATGATCTACAATTACTGCACAGACTT
GAAACGATTCCCTCAAGGCGTTCCAGTTGAATGCAAACAGTCCAGATTCCTTTGA
AA sequence
>Lus10010936 pacid=23172457 polypeptide=Lus10010936 locus=Lus10010936.g ID=Lus10010936.BGIv1.0 annot-version=v1.0
MAATLPMVMLVMMLGHLMAVSNANFNQHFDVTWGHHHAQIMNGGQQLTLSLDKDSGAGFKSKNEYLFGRVDMQLKLIAGNSAGSVTTFYLSSAEGPNHDE
IDFEFLGNSSGSPYTVHTNVFSQGKGNREQQFHLWFDPTAAFHTYTILWNSQRIIFLVDNIPIRVFNNLESMGVPFPNKKPMSIHSSLWNADDWATQGGR
VKADWTKAPFVASYRNFKAEACVWSPSSSSSTCSPGAWQTQGIDAAGRNRIRWVQSKYMIYNYCTDLKRFPQGVPVECKQSRFL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10010936 0 1
AT2G26060 EMB1345 embryo defective 1345, Transdu... Lus10021365 1.4 0.9644
AT4G34640 ERG9, SQS1 squalene synthase 1 (.1) Lus10017499 4.9 0.9510
AT4G33070 Thiamine pyrophosphate depende... Lus10015291 6.9 0.9611
AT3G48660 Protein of unknown function (D... Lus10003120 7.5 0.9633
AT3G05550 Hypoxia-responsive family prot... Lus10033002 12.0 0.9483
AT5G39890 Protein of unknown function (D... Lus10003861 12.3 0.9564
AT5G25940 early nodulin-related (.1) Lus10030052 13.9 0.9537
AT2G44990 MAX3, CCD7, ATC... carotenoid cleavage dioxygenas... Lus10021241 14.1 0.9503
AT5G11420 Protein of unknown function, D... Lus10005474 15.0 0.9414
AT1G43800 Plant stearoyl-acyl-carrier-pr... Lus10018926 15.5 0.9505

Lus10010936 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.