Lus10010938 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G14130 386 / 3e-136 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT3G23730 383 / 4e-135 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT5G57560 377 / 7e-133 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT4G25810 369 / 2e-129 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G57550 362 / 9e-127 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT4G30270 355 / 2e-124 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT4G25820 340 / 7e-118 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1)
AT5G57530 339 / 8e-118 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT5G57540 339 / 9e-118 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
AT2G18800 338 / 4e-117 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031392 583 / 0 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010939 570 / 0 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031393 559 / 0 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010936 532 / 0 AT3G23730 382 / 2e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10003048 525 / 0 AT3G23730 380 / 7e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10034098 516 / 0 AT3G23730 376 / 5e-132 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10007349 444 / 3e-159 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020773 441 / 5e-158 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020772 441 / 5e-158 AT3G23730 393 / 7e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G060500 444 / 4e-159 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201250 444 / 6e-159 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201200 440 / 2e-157 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 422 / 2e-150 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.014G146100 403 / 4e-143 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.002G236200 401 / 4e-142 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.011G077320 387 / 1e-136 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.018G095100 375 / 4e-132 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.013G005700 377 / 5e-132 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095200 373 / 4e-131 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10010938 pacid=23172527 polypeptide=Lus10010938 locus=Lus10010938.g ID=Lus10010938.BGIv1.0 annot-version=v1.0
ATGGCGACTCTGCCTCTGATAATGTCGACATTGGTACTGTTGGGTCATATAATGGCCGTCTCAAATGCGAACTTCCACCAGCATTTCGACGTCACATGGG
GTCAGCACCACGCTCAGATCATGAACACCGGCCAGCAGTTGACACTCTCCCTCGATAAGGATTCCGGCGCCGGATTCAAGTCCAAAAATGAGTACCTCTT
CGGCCGTATCGATATGCAACTCAAGCTCATTGCCGGCAACTCCGCCGGAAGTGTCACCACATTTTATTTGTCATCGGAAGGATCGAACCACGACGAAATT
GACTTCGAATTCCTTGGCAATTCGACCGGAAACCCTTACACCCTCCATACCAATGTGTTCAGTCAAGGAAAAGGCAACCGAGAGCAACAATTCCACCTCT
GGTTCGACCCAACTTCCGCTTTCCACACCTACACCATCCTCTGGAACTCCCAACGAATCATATTCTTAGTGGACAACATTCCGATCAGAGTGTTCAACAA
CTTGGAATCAATGGGAGTGCCATTCCCAAACAAGCAGCCGATGAGCATTCACTCGAGCTTATGGAACGCCGACGACTGGGCTACCCAAGGCGGCCGAGTC
AAGGCCGACTGGACCAAGGCTCCTTTCATAGCTTCTTACAGAAACTTCAAGGCAGAGGCTTGTGTTTGGTCGCCGTCGTCGGCCTCTTCGACTTGCACTC
CGGGAGCGTGGCAGACTCAGGGGATTGATGCCGCCGGCCGGAATAGGATCCGGTGGGTGCAGAGTAAATATATGATATATAATTACTGCACTGACTTGAA
ACGGTTCCCTCAGGGAGTTCCAGTTGAATGCAAGCAGACTAGGTTCCTTTAA
AA sequence
>Lus10010938 pacid=23172527 polypeptide=Lus10010938 locus=Lus10010938.g ID=Lus10010938.BGIv1.0 annot-version=v1.0
MATLPLIMSTLVLLGHIMAVSNANFHQHFDVTWGQHHAQIMNTGQQLTLSLDKDSGAGFKSKNEYLFGRIDMQLKLIAGNSAGSVTTFYLSSEGSNHDEI
DFEFLGNSTGNPYTLHTNVFSQGKGNREQQFHLWFDPTSAFHTYTILWNSQRIIFLVDNIPIRVFNNLESMGVPFPNKQPMSIHSSLWNADDWATQGGRV
KADWTKAPFIASYRNFKAEACVWSPSSASSTCTPGAWQTQGIDAAGRNRIRWVQSKYMIYNYCTDLKRFPQGVPVECKQTRFL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G14130 XTR7, XTH15 xyloglucan endotransglycosylas... Lus10010938 0 1
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10010939 1.0 0.9786
AT3G19680 Protein of unknown function (D... Lus10020509 1.4 0.9187
AT1G77380 AAP3, ATAAP3 amino acid permease 3 (.1) Lus10024302 4.6 0.9107
AT5G44640 BGLU13 beta glucosidase 13 (.1) Lus10024065 6.7 0.8738
AT5G18150 Methyltransferase-related prot... Lus10034423 7.7 0.9095
AT5G26250 Major facilitator superfamily ... Lus10041212 7.9 0.8911
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10020772 8.4 0.8900
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10007348 8.8 0.8944
AT1G76600 unknown protein Lus10036322 9.2 0.8591
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10007349 10.6 0.8756

Lus10010938 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.