Lus10010939 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G23730 384 / 3e-135 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT4G14130 380 / 6e-134 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT5G57560 374 / 2e-131 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT4G25810 366 / 3e-128 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G57550 357 / 1e-124 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT4G30270 350 / 2e-122 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT5G57530 338 / 3e-117 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT5G57540 337 / 7e-117 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
AT5G48070 336 / 2e-116 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1)
AT4G25820 335 / 3e-116 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031393 577 / 0 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010938 571 / 0 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10031392 567 / 0 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010936 527 / 0 AT3G23730 382 / 2e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10003048 525 / 0 AT3G23730 380 / 7e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10034098 520 / 0 AT3G23730 376 / 5e-132 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10007349 442 / 3e-158 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020772 440 / 2e-157 AT3G23730 393 / 7e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020773 440 / 2e-157 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G201250 452 / 2e-162 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201200 447 / 3e-160 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060500 445 / 2e-159 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 422 / 1e-150 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.014G146100 409 / 3e-145 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.002G236200 402 / 1e-142 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.011G077320 389 / 2e-137 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.013G005700 376 / 1e-131 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095100 372 / 1e-130 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095200 369 / 2e-129 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10010939 pacid=23172533 polypeptide=Lus10010939 locus=Lus10010939.g ID=Lus10010939.BGIv1.0 annot-version=v1.0
ATGGCGACCAGTACTCTGCCTCTGTTAATGGTGTTGGCGTGTCATTTAATGGCCATCTCAAATGCAAACTTCCACCAGCATTTCGACGTCACATGGGGTC
AGCACCATGCTCAGATCATGAACACCGGCCAGCAGTTGACACTCTCGCTCGACAAGGATTCCGGCGCCGGATTCAAGTCCAAAAACGAGTACCTCTTCGG
CCGTATCGATATGCAACTCAAGCTCATCGCCGGCAACTCCGCCGGAAGTGTCACCACATTTTATTTGTCATCGGAAGGACCGAACCACGACGAAATCGAC
TTCGAATTCCTTGGCAATTCGACCGGAAACCCTTACACCCTCCATACCAATGTGTTCAGTCAAGGAAAAGGCAACCGAGAGCAACAATTCCACCTCTGGT
TCGACCCAACTTCCGCTTTCCACACCTACACCATCCTCTGGAACTCCCAACGAATCATATTCTTGGTGGACAACATTCCGATTAGAGTGTTCAACAACTT
GGAATCAATGGGAGTGCCATTCCCAAACAAGCAGCCGATGAGCATTCACTCTAGCTTATGGAACGCCGACGACTGGGCTACCCAAGGCGGCCGAGTCAAG
GCCGACTGGACCAAGGCTCCTTTCATAGCTTCTTACAGAAACTTCAAGGCAGAGGCTTGTGTTTGGTCGCCGTCGTCGGCCTCTTCGACTTGCACTCCGG
GAGCGTGGCAGACTCAGGGGATTGATGCTGCCGGCAGGAACAGGATCCGGTGGGTGCAGAGCAAATATATGATCTATAATTACTGCACTGACTTGAAACG
TTTCCCTAAAGGAGTTCCAGTTGAATGCAAGCAGACTAGGTTCCTTTGA
AA sequence
>Lus10010939 pacid=23172533 polypeptide=Lus10010939 locus=Lus10010939.g ID=Lus10010939.BGIv1.0 annot-version=v1.0
MATSTLPLLMVLACHLMAISNANFHQHFDVTWGQHHAQIMNTGQQLTLSLDKDSGAGFKSKNEYLFGRIDMQLKLIAGNSAGSVTTFYLSSEGPNHDEID
FEFLGNSTGNPYTLHTNVFSQGKGNREQQFHLWFDPTSAFHTYTILWNSQRIIFLVDNIPIRVFNNLESMGVPFPNKQPMSIHSSLWNADDWATQGGRVK
ADWTKAPFIASYRNFKAEACVWSPSSASSTCTPGAWQTQGIDAAGRNRIRWVQSKYMIYNYCTDLKRFPKGVPVECKQTRFL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10010939 0 1
AT4G14130 XTR7, XTH15 xyloglucan endotransglycosylas... Lus10010938 1.0 0.9786
AT1G77380 AAP3, ATAAP3 amino acid permease 3 (.1) Lus10024302 2.0 0.9445
AT5G44640 BGLU13 beta glucosidase 13 (.1) Lus10024065 2.4 0.9066
AT4G31500 SUR2, RNT1, RED... SUPERROOT 2, RUNT 1, RED ELONG... Lus10034505 3.5 0.9391
AT1G23420 YABBY INO, YAB4 INNER NO OUTER, Plant-specific... Lus10030596 5.7 0.9342
AT1G76600 unknown protein Lus10036322 7.9 0.8620
AT4G23030 MATE efflux family protein (.1... Lus10027417 8.0 0.9044
AT4G24110 unknown protein Lus10017328 8.2 0.8737
Lus10034979 10.5 0.9075
AT3G19680 Protein of unknown function (D... Lus10020509 10.8 0.8826

Lus10010939 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.